Western Blot (WB)
(WB Suggested Anti-IL22 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Rabbit IL22 Polyclonal Antibody | anti-IL22 antibody
IL22 antibody - C-terminal region
Gene Names
IL22; TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
Reactivity
Tested species: HumanPredicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL22; Polyclonal Antibody; IL22 antibody - C-terminal region; anti-IL22 antibody
Host
Rabbit
Reactivity
Tested species: Human
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Sequence Length
179
Applicable Applications for anti-IL22 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Goat: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IL22
Protein size (#AA)
179 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IL22 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-IL22 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-IL22 antibody
This is a rabbit polyclonal antibody against IL22. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.
Target Description: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.
Product Categories/Family for anti-IL22 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
interleukin-22
NCBI Official Synonym Full Names
interleukin 22
NCBI Official Symbol
IL22
NCBI Official Synonym Symbols
TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
NCBI Protein Information
interleukin-22
UniProt Protein Name
Interleukin-22
Protein Family
UniProt Gene Name
IL22
UniProt Synonym Gene Names
ILTIF; ZCYTO18; IL-22; IL-TIF
UniProt Entry Name
IL22_HUMAN
NCBI Description
This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018]
Uniprot Description
IL22: Cytokine that contributes to the inflammatory response in vivo. Belongs to the IL-10 family.
Protein type: Secreted, signal peptide; Cytokine; Secreted
Chromosomal Location of Human Ortholog: 12q15
Cellular Component: extracellular space; extracellular region
Molecular Function: interleukin-22 receptor binding; cytokine activity
Biological Process: cell-cell signaling; response to glucocorticoid stimulus; acute-phase response; inflammatory response
Research Articles on IL22
Similar Products
Product Notes
The IL22 il22 (Catalog #AAA3209500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL22 antibody - C-terminal region reacts with Tested species: Human Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IL22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL22 il22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CHIEGDDLHI QRNVQKLKDT VKKLGESGEI KAIGELDLLF MSLRNACI. It is sometimes possible for the material contained within the vial of "IL22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
