Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL19Sample Type: Jurkat whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit IL19 Polyclonal Antibody | anti-IL19 antibody

IL19 Antibody - C-terminal region

Gene Names
IL19; MDA1; NG.1; ZMDA1; IL-10C
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL19; Polyclonal Antibody; IL19 Antibody - C-terminal region; anti-IL19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLE
Sequence Length
215
Applicable Applications for anti-IL19 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Human: 100%; Mouse: 85%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL19
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL19Sample Type: Jurkat whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL19Sample Type: Jurkat whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IL19 antibody
This is a rabbit polyclonal antibody against IL19. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.
Product Categories/Family for anti-IL19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
interleukin-19 isoform 1
NCBI Official Synonym Full Names
interleukin 19
NCBI Official Symbol
IL19
NCBI Official Synonym Symbols
MDA1; NG.1; ZMDA1; IL-10C
NCBI Protein Information
interleukin-19
UniProt Protein Name
Interleukin-19
Protein Family
UniProt Gene Name
IL19
UniProt Synonym Gene Names
ZMDA1; IL-19
UniProt Entry Name
IL19_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

IL19: May play some important roles in inflammatory responses. Up-regulates IL-6 and TNF-alpha and induces apoptosis. Belongs to the IL-10 family.

Protein type: Secreted, signal peptide; Secreted; Cytokine; Apoptosis

Chromosomal Location of Human Ortholog: 1q32.2

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: apoptosis; positive regulation of JAK-STAT cascade; immune response; signal transduction; inflammatory response; interleukin-6 biosynthetic process

Research Articles on IL19

Similar Products

Product Notes

The IL19 il19 (Catalog #AAA3216280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL19 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL19 il19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KILRKISSIA NSFLYMQKTL RQCQEQRQCH CRQEATNATR VIHDNYDQLE. It is sometimes possible for the material contained within the vial of "IL19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.