Western Blot (WB)
(WB Suggested Anti-IL17D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Rabbit IL17D Polyclonal Antibody | anti-IL17D antibody
IL17D antibody - N-terminal region
Gene Names
IL17D; IL-17D
Reactivity
Cow, Guinea Pig, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL17D; Polyclonal Antibody; IL17D antibody - N-terminal region; anti-IL17D antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV
Sequence Length
202
Applicable Applications for anti-IL17D antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL17D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IL17D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-IL17D Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-IL17D antibody
This is a rabbit polyclonal antibody against IL17D. It was validated on Western Blot
Target Description: The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent.
Target Description: The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent.
Product Categories/Family for anti-IL17D antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
interleukin-17D
NCBI Official Synonym Full Names
interleukin 17D
NCBI Official Symbol
IL17D
NCBI Official Synonym Symbols
IL-17D
NCBI Protein Information
interleukin-17D
UniProt Protein Name
Interleukin-17D
Protein Family
UniProt Gene Name
IL17D
UniProt Synonym Gene Names
IL27; IL-17D; IL-27
UniProt Entry Name
IL17D_HUMAN
NCBI Description
The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. The treatment of endothelial cells with this cytokine has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2/ GM-CSF. The increased expression of IL8 induced by this cytokine was found to be NF-kappa B-dependent. [provided by RefSeq, Jul 2008]
Uniprot Description
IL17D: Induces expression of IL-6, IL-8, and GM-CSF from endothelial cells. Belongs to the IL-17 family.
Protein type: Secreted, signal peptide; Cytokine; Secreted
Chromosomal Location of Human Ortholog: 13q11
Cellular Component: extracellular space
Molecular Function: cytokine activity
Biological Process: inflammatory response
Research Articles on IL17D
Similar Products
Product Notes
The IL17D il17d (Catalog #AAA3213524) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL17D antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IL17D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL17D il17d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLVAGFLLAL PPSWAAGAPR AGRRPARPRG CADRPEELLE QLYGRLAAGV. It is sometimes possible for the material contained within the vial of "IL17D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
