Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL10RA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit IL10RA Polyclonal Antibody | anti-IL10RA antibody

IL10RA antibody - N-terminal region

Gene Names
IL10RA; CD210; IL10R; CD210a; CDW210A; HIL-10R; IL-10R1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
IL10RA; Polyclonal Antibody; IL10RA antibody - N-terminal region; anti-IL10RA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Sequence Length
578
Applicable Applications for anti-IL10RA antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IL10RA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL10RA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-IL10RA Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-IL10RA antibody
This is a rabbit polyclonal antibody against IL10RA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.
Product Categories/Family for anti-IL10RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
interleukin-10 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 10 receptor subunit alpha
NCBI Official Symbol
IL10RA
NCBI Official Synonym Symbols
CD210; IL10R; CD210a; CDW210A; HIL-10R; IL-10R1
NCBI Protein Information
interleukin-10 receptor subunit alpha
UniProt Protein Name
Interleukin-10 receptor subunit alpha
Protein Family
UniProt Gene Name
IL10RA
UniProt Synonym Gene Names
IL10R; IL-10 receptor subunit alpha; IL-10R subunit alpha; IL-10RA; IL-10R subunit 1; IL-10R1
UniProt Entry Name
I10R1_HUMAN

NCBI Description

The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Jan 2009]

Uniprot Description

IL10RA: a receptor for interleukin 10 structurally related to interferon receptors. Mediates the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: plasma membrane; integral to membrane

Molecular Function: signal transducer activity; protein binding; interleukin-10 binding; interleukin-10 receptor activity; receptor activity

Biological Process: cytokine and chemokine mediated signaling pathway; response to lipopolysaccharide

Disease: Inflammatory Bowel Disease 28, Autosomal Recessive

Research Articles on IL10RA

Similar Products

Product Notes

The IL10RA il10ra (Catalog #AAA3207661) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL10RA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL10RA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL10RA il10ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSVNLEIHNG FILGKIQLPR PKMAPANDTY ESIFSHFREY EIAIRKVPGN. It is sometimes possible for the material contained within the vial of "IL10RA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.