Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 10ug 293T lysate (empty vector)Lane 2: 10ug IKKalpha-V5 transfected 293T lysateLane 3: 10ug IKKbeta-V5 transfected 293TPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:IKBKBSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Rabbit IKBKB Polyclonal Antibody | anti-IKBKB antibody

IKBKB antibody - middle region

Gene Names
IKBKB; IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IKBKB; Polyclonal Antibody; IKBKB antibody - middle region; anti-IKBKB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ITYETQISPRPQPESVSCILQEPKRNLAFFQLRKVWGQVWHSIQTLKEDC
Sequence Length
756
Applicable Applications for anti-IKBKB antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IKBKB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 10ug 293T lysate (empty vector)Lane 2: 10ug IKKalpha-V5 transfected 293T lysateLane 3: 10ug IKKbeta-V5 transfected 293TPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:IKBKBSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Western Blot (WB) (Lanes:Lane 1: 10ug 293T lysate (empty vector)Lane 2: 10ug IKKalpha-V5 transfected 293T lysateLane 3: 10ug IKKbeta-V5 transfected 293TPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:IKBKBSubmitted by:Dr. Tencho Tenev, The Breakthrough Breast Cancer Research Centre, Institute of Cancer Research)

Western Blot (WB)

(WB Suggested Anti-IKBKB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-IKBKB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-IKBKB antibody
This is a rabbit polyclonal antibody against IKBKB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFKB1 or NFKB2 is bound to REL, RELA, or RELB to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-203 AL708460.1 9-211 204-3077 AF080158.1 170-3043 3078-3916 AK023193.1 1980-2818

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
inhibitor of nuclear factor kappa-B kinase subunit beta isoform 1
NCBI Official Synonym Full Names
inhibitor of nuclear factor kappa B kinase subunit beta
NCBI Official Symbol
IKBKB
NCBI Official Synonym Symbols
IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB; IKK-beta
NCBI Protein Information
inhibitor of nuclear factor kappa-B kinase subunit beta
UniProt Protein Name
Inhibitor of nuclear factor kappa-B kinase subunit beta
UniProt Gene Name
IKBKB
UniProt Synonym Gene Names
IKKB; I-kappa-B-kinase beta; IKK-B; IKK-beta; IkBKB; IKK2; NFKBIKB
UniProt Entry Name
IKKB_HUMAN

NCBI Description

The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

IKKB: a kinase of the IKK family. Phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Preferentially found as a heterodimer with IKK-alpha but also as an homodimer.

Protein type: EC 2.7.11.10; Protein kinase, Other; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Other group; IKK family

Chromosomal Location of Human Ortholog: 8p11.2

Cellular Component: internal side of plasma membrane; cytoplasm; IkappaB kinase complex; nucleus; cytosol; lipid raft

Molecular Function: protein serine/threonine kinase activity; protein binding; protein homodimerization activity; IkappaB kinase activity; protein heterodimerization activity; protein kinase binding; ATP binding; protein kinase activity

Biological Process: I-kappaB kinase/NF-kappaB cascade; positive regulation of I-kappaB kinase/NF-kappaB cascade; nerve growth factor receptor signaling pathway; MyD88-independent toll-like receptor signaling pathway; response to virus; positive regulation of transcription, DNA-dependent; toll-like receptor 3 signaling pathway; T cell receptor signaling pathway; protein amino acid phosphorylation; toll-like receptor 2 signaling pathway; activation of NF-kappaB transcription factor; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; serine phosphorylation of STAT protein; B cell homeostasis; toll-like receptor signaling pathway; positive regulation of interferon type I production; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; inflammatory response; I-kappaB phosphorylation; toll-like receptor 4 signaling pathway; negative regulation of apoptosis

Disease: Immunodeficiency 15

Research Articles on IKBKB

Similar Products

Product Notes

The IKBKB ikbkb (Catalog #AAA3200689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IKBKB antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IKBKB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IKBKB ikbkb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITYETQISPR PQPESVSCIL QEPKRNLAFF QLRKVWGQVW HSIQTLKEDC. It is sometimes possible for the material contained within the vial of "IKBKB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.