Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IFNA2Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human IFNA2 Polyclonal Antibody | anti-IFNA2 antibody

IFNA2 Antibody - middle region

Gene Names
IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
IFNA2; Polyclonal Antibody; IFNA2 Antibody - middle region; anti-IFNA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSVGCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQ
Sequence Length
189
Applicable Applications for anti-IFNA2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IFNA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IFNA2Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IFNA2Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IFNA2 antibody
This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold.
Product Categories/Family for anti-IFNA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
interferon alpha-2
NCBI Official Synonym Full Names
interferon alpha 2
NCBI Official Symbol
IFNA2
NCBI Official Synonym Symbols
IFNA; INFA2; IFNA2B; IFN-alphaA
NCBI Protein Information
interferon alpha-2
UniProt Protein Name
Interferon alpha-1/13
UniProt Gene Name
IFNA1
UniProt Synonym Gene Names
IFN-alpha-1/13; LeIF D
UniProt Entry Name
IFNA1_HUMAN

NCBI Description

This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011]

Uniprot Description

IFNA1/13: a cytokine that belongs to the alpha/beta interferon family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9p22

Cellular Component: extracellular space; extracellular region

Molecular Function: interferon-alpha/beta receptor binding; cytokine activity

Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; regulation of MHC class I biosynthetic process; humoral immune response; T cell activation during immune response; response to exogenous dsRNA; B cell differentiation; natural killer cell activation during immune response; innate immune response; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein

Research Articles on IFNA2

Similar Products

Product Notes

The IFNA2 ifna1 (Catalog #AAA3221152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNA2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFNA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFNA2 ifna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSVGCDLPQT HSLGSRRTLM LLAQMRKISL FSCLKDRHDF GFPQEEFGNQ. It is sometimes possible for the material contained within the vial of "IFNA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.