Western Blot (WB)
(WB Suggested Anti-IFNA13 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Rabbit IFNA13 Polyclonal Antibody | anti-IFNA13 antibody
IFNA13 antibody - C-terminal region
Reactivity
Cow, Dog, Goat, Human, Pig, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFNA13; Polyclonal Antibody; IFNA13 antibody - C-terminal region; anti-IFNA13 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
Sequence Length
189
Applicable Applications for anti-IFNA13 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 83%; Goat: 83%; Human: 100%; Pig: 92%; Sheep: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IFNA13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IFNA13 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Western Blot (WB)
(WB Suggested Anti-IFNA13 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-IFNA13 antibody
This is a rabbit polyclonal antibody against IFNA13. It was validated on Western Blot
Target Description: IFNA13 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Target Description: IFNA13 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Product Categories/Family for anti-IFNA13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
interferon alpha-1/13
NCBI Official Synonym Full Names
interferon alpha 13
NCBI Official Symbol
IFNA13
NCBI Protein Information
interferon alpha-1/13
UniProt Protein Name
Interferon alpha-1/13
Protein Family
UniProt Gene Name
IFNA1
UniProt Synonym Gene Names
IFN-alpha-1/13; LeIF D
UniProt Entry Name
IFNA1_HUMAN
Uniprot Description
IFNA1/13: a cytokine that belongs to the alpha/beta interferon family.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 9p22
Cellular Component: extracellular space; extracellular region
Molecular Function: interferon-alpha/beta receptor binding; cytokine activity
Biological Process: B cell proliferation; adaptive immune response; cytokine and chemokine mediated signaling pathway; regulation of MHC class I biosynthetic process; humoral immune response; T cell activation during immune response; response to exogenous dsRNA; B cell differentiation; natural killer cell activation during immune response; innate immune response; blood coagulation; defense response to virus; positive regulation of peptidyl-serine phosphorylation of STAT protein
Research Articles on IFNA13
1. Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
Similar Products
Product Notes
The IFNA13 ifna1 (Catalog #AAA3214925) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFNA13 antibody - C-terminal region reacts with Cow, Dog, Goat, Human, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IFNA13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IFNA13 ifna1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILAVKKYFRR ITLYLTEKKY SPCAWEVVRA EIMRSLSLST NLQERLRRKE. It is sometimes possible for the material contained within the vial of "IFNA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
