Rabbit anti-Human IDH3B Polyclonal Antibody | anti-IDH3B antibody

IDH3B (FLJ11043, Isocitrate Dehydrogenase [NAD] Subunit beta, Mitochondrial, Isocitric Dehydrogenase Subunit beta, NAD(+)-specific ICDH Subunit beta, MGC903)

Cat. Num. AAA6000921

• Gene Names: IDH3B; RP46; H-IDHB
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: IDH3B; Polyclonal Antibody; IDH3B (FLJ11043; Isocitrate Dehydrogenase [NAD] Subunit beta; Mitochondrial; Isocitric Dehydrogenase Subunit beta; NAD(+)-specific ICDH Subunit beta; MGC903); Anti -IDH3B (FLJ11043; anti-IDH3B antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IDH3B.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS

• Applicable Applications for anti-IDH3B antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human IDH3B, aa1-385 (NP_008830.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IDH3B expression in transfected 293T cell line by IDH3B polyclonal antibody. Lane 1: IDH3B transfected lysate (42.2kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-IDH3B antibody

Defects in IDH3B are the cause of retinitis pigmentosa type 46 (RP46) [MIM:612572]. RP is a retinal dystrophy belonging to the group of pigmentary retinopathies. RP is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.

Product Categories/Family for anti-IDH3B antibody

Antibodies; Abs to Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 385648280
• NCBI GeneID: 3420
• NCBI Accession #: NP_001245313.1
• NCBI GenBank Nucleotide #: NM_001258384.1
• UniProt Accession #: O43837; O95106; Q5JXS8; Q9NQ06; Q9NQ07; Q9NUZ0; Q9UEX0; Q9UG99; B2RDR1; D3DVX2; D3DVX3
• Molecular Weight: 42,184 Da
• NCBI Official Full Name: isocitrate dehydrogenase
• NCBI Official Synonym Full Names: isocitrate dehydrogenase 3 (NAD+) beta
• NCBI Official Symbol: IDH3B
• NCBI Official Synonym Symbols: RP46; H-IDHB
• NCBI Protein Information: isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; isocitrate dehydrogenase [NAD] subunit beta, mitochondrial; NAD+-specific ICDH; NAD(+)-specific ICDH subunit beta; isocitric dehydrogenase subunit beta; NAD+-specific isocitrate dehydrogenase beta; NAD+-specific isocitrate dehydrogenase b subunit; isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit
• UniProt Protein Name: Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
• Protein Family: Isocitrate dehydrogenase
• UniProt Gene Name: IDH3B
• UniProt Entry Name: IDH3B_HUMAN

NCBI Description

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

IDH3B: a enzyme that that catalyzes the oxidative decarboxylation of isocitrate to alpha-ketoglutarate (alpha-KG), requiring nicotinamide adenine dinucleotide (NAD) as a cofactor. The holoenzyme is a heterooligomer of subunits alpha, beta, and gamma in the apparent ratio of 2:1:1. IDH3 is a mitochondrial enzyme that functions in the Krebs cycle, which generates substrates for cellular respiration. Alpha-KG can exit the mitochondria and enter other cellular compartments where it is a cofactor for the dioxygenases that hydroxylate the transcription factor HIF and trigger its degradation by VHL. Since HIF turns on oncogenic pathways, IDH3 has apparent tumor suppressor activity. Two isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - citrate (TCA) cycle; EC 1.1.1.41; Mitochondrial; Oxidoreductase

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: mitochondrion; mitochondrial matrix; nucleus

Molecular Function: electron carrier activity; magnesium ion binding; isocitrate dehydrogenase (NAD+) activity; NAD binding

Biological Process: isocitrate metabolic process; cellular metabolic process; NADH metabolic process; tricarboxylic acid cycle; 2-oxoglutarate metabolic process

Disease: Retinitis Pigmentosa 46