Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ID4 Polyclonal Antibody)

Rabbit anti-Mouse, Rat ID4 Polyclonal Antibody | anti-ID4 antibody

ID4 Polyclonal Antibody

Gene Names
ID4; IDB4; bHLHb27
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ID4; Polyclonal Antibody; ID4 Polyclonal Antibody; IDB4; bHLHb27; DNA-binding protein inhibitor ID-4; anti-ID4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.85 mg/ml (varies by lot)
Sequence Length
161
Applicable Applications for anti-ID4 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1).
Immunogen Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ID4 Polyclonal Antibody)

Western Blot (WB) (Western blot-ID4 Polyclonal Antibody)
Related Product Information for anti-ID4 antibody
This gene encodes a member of the inhibitor of DNA binding (ID) protein family. These proteins are basic helix-loop-helix transcription factors which can act as tumor suppressors but lack DNA binding activity. Consequently, the activity of the encoded protein depends on the protein binding partner.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 16kDa
Observed: 20kDa
NCBI Official Full Name
DNA-binding protein inhibitor ID-4
NCBI Official Synonym Full Names
inhibitor of DNA binding 4, HLH protein
NCBI Official Symbol
ID4
NCBI Official Synonym Symbols
IDB4; bHLHb27
NCBI Protein Information
DNA-binding protein inhibitor ID-4
UniProt Protein Name
DNA-binding protein inhibitor ID-4
UniProt Gene Name
ID4
UniProt Synonym Gene Names
BHLHB27; bHLHb27
UniProt Entry Name
ID4_HUMAN

NCBI Description

This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]

Uniprot Description

ID4: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription corepressor activity

Biological Process: fat cell differentiation; circadian rhythm; transcription, DNA-dependent; myelination in the central nervous system; hippocampus development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of fat cell differentiation; cerebral cortex neuron differentiation; regulation of transcription from RNA polymerase II promoter; negative regulation of oligodendrocyte differentiation; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; positive regulation of cell proliferation; negative regulation of astrocyte differentiation; neuroblast proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; G1/S transition of mitotic cell cycle

Research Articles on ID4

Similar Products

Product Notes

The ID4 id4 (Catalog #AAA9140785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ID4 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ID4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ID4 id4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ID4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.