Rabbit anti-Mouse, Rat ID4 Polyclonal Antibody | anti-ID4 antibody

ID4 Polyclonal Antibody

Cat. Num. AAA9140785

• Gene Names: ID4; IDB4; bHLHb27
• Reactivity: Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: ID4; Polyclonal Antibody; ID4 Polyclonal Antibody; IDB4; bHLHb27; DNA-binding protein inhibitor ID-4; anti-ID4 antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 2.85 mg/ml (varies by lot)
• Sequence Length: 161

• Applicable Applications for anti-ID4 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ID4 (NP_001537.1).
• Immunogen Sequence: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ID4 Polyclonal Antibody)

Related Product Information for anti-ID4 antibody

This gene encodes a member of the inhibitor of DNA binding (ID) protein family. These proteins are basic helix-loop-helix transcription factors which can act as tumor suppressors but lack DNA binding activity. Consequently, the activity of the encoded protein depends on the protein binding partner.

NCBI and Uniprot Product Information

• NCBI GI #: 4504573
• NCBI GeneID: 3400
• NCBI Accession #: NP_001537.1
• NCBI GenBank Nucleotide #: NP_001537.1
• UniProt Accession #: P47928
• Molecular Weight: Calculated: 16kDa; Observed: 20kDa
• NCBI Official Full Name: DNA-binding protein inhibitor ID-4
• NCBI Official Synonym Full Names: inhibitor of DNA binding 4, HLH protein
• NCBI Official Symbol: ID4
• NCBI Official Synonym Symbols: IDB4; bHLHb27
• NCBI Protein Information: DNA-binding protein inhibitor ID-4
• UniProt Protein Name: DNA-binding protein inhibitor ID-4
• Protein Family: DNA-binding protein inhibitor
• UniProt Gene Name: ID4
• UniProt Synonym Gene Names: BHLHB27; bHLHb27
• UniProt Entry Name: ID4_HUMAN

NCBI Description

This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017]

Uniprot Description

ID4: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; transcription corepressor activity

Biological Process: fat cell differentiation; circadian rhythm; transcription, DNA-dependent; myelination in the central nervous system; hippocampus development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of fat cell differentiation; cerebral cortex neuron differentiation; regulation of transcription from RNA polymerase II promoter; negative regulation of oligodendrocyte differentiation; positive regulation of osteoblast differentiation; negative regulation of neuron differentiation; positive regulation of cell proliferation; negative regulation of astrocyte differentiation; neuroblast proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; G1/S transition of mitotic cell cycle