Western Blot (WB)
(HYI rabbit polyclonal antibody. Western Blot analysis of HYI expression in human liver.)
Rabbit anti-Human, Mouse HYI Polyclonal Antibody | anti-HYI antibody
HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) APC
Gene Names
HYI; HT036
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HYI; Polyclonal Antibody; HYI (Putative Hydroxypyruvate Isomerase; Endothelial Cell Apoptosis Protein E-CE1; HT036; SB156; MGC20767) APC; anti-HYI antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HYI. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
953
Applicable Applications for anti-HYI antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HYI, aa1-174 (AAH19041.1).
Immunogen Sequence
MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQEDLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQVAQVPGRGEPSSPGELNFPYLFQLLEDEGYKGFVG
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(HYI rabbit polyclonal antibody. Western Blot analysis of HYI expression in human liver.)
Western Blot (WB)
(HYI rabbit polyclonal antibody. Western Blot analysis of HYI expression in human liver.)
Western Blot (WB)
(HYI rabbit polyclonal antibody. Western Blot analysis of HYI expression in mouse liver.)
Western Blot (WB)
(HYI rabbit polyclonal antibody. Western Blot analysis of HYI expression in mouse liver.)
Western Blot (WB)
(Western Blot analysis of HYI expression in transfected 293T cell line by HYI polyclonal antibody. Lane 1: HYI transfected lysate (19.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HYI expression in transfected 293T cell line by HYI polyclonal antibody. Lane 1: HYI transfected lysate (19.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HYI antibody
Catalyzes the reversible isomerization between hydroxypyruvate and 2-hydroxy-3-oxopropanoate (also termed tartronate semialdehyde).
Product Categories/Family for anti-HYI antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens hydroxypyruvate isomerase homolog (E. coli), mRNA
NCBI Official Synonym Full Names
hydroxypyruvate isomerase (putative)
NCBI Official Symbol
HYI
NCBI Official Synonym Symbols
HT036
NCBI Protein Information
putative hydroxypyruvate isomerase
Protein Family
NCBI Description
This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Research Articles on HYI
1. Protein HYI may closely bind with protein P311 by an alpha helix in hypertrophic scar fibroblasts.
Similar Products
Product Notes
The HYI (Catalog #AAA6381937) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HYI (Putative Hydroxypyruvate Isomerase, Endothelial Cell Apoptosis Protein E-CE1, HT036, SB156, MGC20767) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HYI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HYI for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HYI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
