Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Goat HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 Polyclonal Antibody | anti-env antibody

GOAT ANTI HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 (aa502-541)

Applications
ELISA, Immunoblot, Western Blot
Purity
>98%
Synonyms
HUMAN IMMUNODEFICIENCY VIRUS 1 gp41; Polyclonal Antibody; GOAT ANTI HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 (aa502-541); anti-env antibody
Ordering
For Research Use Only!
Host
Goat
Clonality
Polyclonal
Isotype
IgG
Specificity
This item recognises gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.
Purity/Purification
>98%
Form/Format
Purified
Purified IgG - liquid
Concentration
IgG concentration 1.0 mg/ml (varies by lot)
Sequence Length
856
Applicable Applications for anti-env antibody
ELISA (EIA), Immunoblotting (IB)
Application Notes
ELISA: Minimum Dilution: 1/50; Maximum Dilution: 1/500;
Immunoblotting: Minimum Dilution: 1/50; Maximum Dilution: 1/500
Perservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Synthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR
Buffer Solution
Target Species
Viral
Preparation and Storage
Store at 4 degree C or at -20 degree C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life: 18 months from date of despatch.
Related Product Information for anti-env antibody
MBS224262 recognises gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
96,938 Da
NCBI Official Full Name
Envelope glycoprotein gp160
UniProt Protein Name
Envelope glycoprotein gp160
Protein Family
UniProt Gene Name
env
UniProt Synonym Gene Names
SU; gp120; TM; gp41
UniProt Entry Name
ENV_HV1LW

Uniprot Description

Envelope glycoprotein gp160: Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.

Similar Products

Product Notes

The HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 env (Catalog #AAA224262) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoblotting (IB). ELISA: Minimum Dilution: 1/50; Maximum Dilution: 1/500; Immunoblotting: Minimum Dilution: 1/50; Maximum Dilution: 1/500. Researchers should empirically determine the suitability of the HUMAN IMMUNODEFICIENCY VIRUS 1 gp41 env for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HUMAN IMMUNODEFICIENCY VIRUS 1 gp41, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.