Western Blot (WB)
(WB Suggested Anti-Hspb7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Rabbit Hspb7 Polyclonal Antibody | anti-HSPB7 antibody
Hspb7 antibody - middle region
Gene Names
Hspb7; 27kDa; cvHsp; Hsp25-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hspb7; Polyclonal Antibody; Hspb7 antibody - middle region; anti-HSPB7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF
Sequence Length
169
Applicable Applications for anti-HSPB7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 90%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Hspb7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Hspb7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Heart)
Related Product Information for anti-HSPB7 antibody
This is a rabbit polyclonal antibody against Hspb7. It was validated on Western Blot
Target Description: The function of Hspb7 remains unknown.
Target Description: The function of Hspb7 remains unknown.
Product Categories/Family for anti-HSPB7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
heat shock protein beta-7
NCBI Official Synonym Full Names
heat shock protein family, member 7 (cardiovascular)
NCBI Official Symbol
Hspb7
NCBI Official Synonym Symbols
27kDa; cvHsp; Hsp25-2
NCBI Protein Information
heat shock protein beta-7
UniProt Protein Name
Heat shock protein beta-7
Protein Family
UniProt Gene Name
Hspb7
UniProt Synonym Gene Names
Cvhsp; Hsp25-2; HspB7; cvHsp
UniProt Entry Name
HSPB7_MOUSE
Uniprot Description
HSPB7: Belongs to the small heat shock protein (HSP20) family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Heat shock protein
Cellular Component: mitochondrion; cytoplasm; nucleus; actin cytoskeleton
Molecular Function: filamin binding
Biological Process: response to heat
Research Articles on HSPB7
Similar Products
Product Notes
The HSPB7 hspb7 (Catalog #AAA3205938) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hspb7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hspb7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSPB7 hspb7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGSFMLPHSE PLAFPARPGG QGNIKTLGDA YEFTVDMRDF SPEDIIVTTF. It is sometimes possible for the material contained within the vial of "Hspb7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
