Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-USP13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit USP13 Polyclonal Antibody | anti-USP13 antibody

USP13 antibody - N-terminal region

Gene Names
USP13; ISOT3; IsoT-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
USP13; Polyclonal Antibody; USP13 antibody - N-terminal region; anti-USP13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDNGVRIPPSGWK
Sequence Length
863
Applicable Applications for anti-USP13 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human USP13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-USP13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-USP13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-USP13 antibody
This is a rabbit polyclonal antibody against USP13. It was validated on Western Blot

Target Description: The function of USP13 remains unknown.
Product Categories/Family for anti-USP13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 13
NCBI Official Synonym Full Names
ubiquitin specific peptidase 13
NCBI Official Symbol
USP13
NCBI Official Synonym Symbols
ISOT3; IsoT-3
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 13
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 13
UniProt Gene Name
USP13
UniProt Synonym Gene Names
ISOT3; ISOT-3
UniProt Entry Name
UBP13_HUMAN

Uniprot Description

USP13: Deubiquitinase that mediates deubiquitination of target proteins such as BECN1, MITF, SKP2 and USP10 and is involved in various processes such as autophagy and endoplasmic reticulum- associated degradation (ERAD). Component of a regulatory loop that controls autophagy and p53/TP53 levels: mediates deubiquitination of BECN1, a key regulator of autophagy, leading to stabilize the PIK3C3/VPS34-containing complexes. Also deubiquitinates USP10, an essential regulator of p53/TP53 stability. In turn, PIK3C3/VPS34- containing complexes regulate USP13 stability, suggesting the existence of a regulatory system by which PIK3C3/VPS34-containing complexes regulate p53/TP53 protein levels via USP10 and USP13. Recruited by nuclear UFD1 and mediates deubiquitination of SKP2, thereby regulating endoplasmic reticulum-associated degradation (ERAD). Mediates stabilization of SIAH2 independently of deubiquitinase activity: binds ubiquitinated SIAH2 and acts by impairing SIAH2 autoubiquitination. Has a weak deubiquitinase activity in vitro and preferentially cleaves 'Lys-63'-linked polyubiquitin chains. In contrast to USP5, it is not able to mediate unanchored polyubiquitin disassembly. Able to cleave ISG15 in vitro; however, additional experiments are required to confirm such data. Belongs to the peptidase C19 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.12; Protease; Ubiquitin-specific protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 3q26.2-q26.3

Cellular Component: lysosome

Molecular Function: omega peptidase activity; ubiquitin binding; protein binding; zinc ion binding; ubiquitin protein ligase binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: cell proliferation; proteasomal ubiquitin-dependent protein catabolic process; regulation of transcription, DNA-dependent; protein stabilization; melanocyte differentiation; autophagy; regulation of autophagy

Research Articles on USP13

Similar Products

Product Notes

The USP13 usp13 (Catalog #AAA3214280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP13 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USP13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP13 usp13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIACDAVLSS KSPYRKQDPD TWENELPVSK YANNLTQLDN GVRIPPSGWK. It is sometimes possible for the material contained within the vial of "USP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.