HSPA2 Polyclonal Antibody | anti-HSPA2 antibody

Anti-HSPA2 Antibody

Cat. Num. AAA177867

• Gene Names: HSPA2; HSP70-2; HSP70-3
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: HSPA2; Polyclonal Antibody; Anti-HSPA2 Antibody; Heat shock-related 70 kDa protein 2; 70kDa; DAQB 147D11.1 001; Hcp70.2; Heat shock 70 kDa protein 2; heat shock 70kDa protein 1A; Heat shock protein 2; heat shock protein 70; Heat shock protein 70.2; Heat shock related 70 kDa protein 2; Heat-shock protein; 70-KD; 2; 3; HSP70 2; HSP70 3; Hsp70-2; HSP70-3; HSP70.2; HSP70A2; HSP72; HSP72_HUMAN; Hspt70; Hst70; MGC58299; MGC7795; MGC93458; OTTHUMP00000180664; Testis-specific heat shock protein-related; XXbac BCX40G17.3 001 antibody; heat shock 70kDa protein 2; anti-HSPA2 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 639

• Applicable Applications for anti-HSPA2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- HSPA2 Picoband antibody, MBS177867, Western blottingAll lanes: Anti HSPA2 (MBS177867) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Kidney Tissue Lysate at 50ugLane 6: HELA Whole Cell Lysate at 40ugLane 7: MCF-7 Whole Cell Lysate at 40ugLane 8: A375 Whole Cell Lysate at 40ugLane 9: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD )

Immunohistochemistry (IHC)

(Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)IHC(P): Mouse Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)IHC(P): Rat Intestine Tissue )

Immunohistochemistry (IHC)

(Anti- HSPA2 Picoband antibody, MBS177867,IHC(P)IHC(P): Human Lung Cancer Tissue )

Related Product Information for anti-HSPA2 antibody

Description: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.

References

1. Bonnycastle, L. L. C., Yu, C.-E., Hunt, C. R., Trask, B. J., Clancy, K. P., Weber, J. L., Patterson, D., Schellenberg, G. D. Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2). Genomics 23: 85-93, 1994. 2. Dix, D. J., Allen, J. W., Collins, B. W., Mori, C., Nakamura, N., Poorman-Allen, P., Goulding, E. H., Eddy, E. M. Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility. Proc. Nat. Acad. Sci. 93: 3264-3268, 1996. 3. Hunt, C. R., Gasser, D. L., Chaplin, D. D., Pierce, J. C., Kozak, C. A. Chromosomal localization of five murine HSP70 gene family members: Hsp70-1, Hsp70-2, Hsp70-3, Hsc70t and Grp78. Genomics 16: 193-198, 1993.

NCBI and Uniprot Product Information

• NCBI GI #: 13676857
• NCBI GeneID: 3306
• NCBI Accession #: NP_068814.2
• NCBI GenBank Nucleotide #: NM_021979.3
• UniProt Accession #: P54652; Q15508; Q53XM3; Q9UE78
• Molecular Weight: 70,021 Da
• NCBI Official Full Name: heat shock-related 70 kDa protein 2
• NCBI Official Synonym Full Names: heat shock protein family A (Hsp70) member 2
• NCBI Official Symbol: HSPA2
• NCBI Official Synonym Symbols: HSP70-2; HSP70-3
• NCBI Protein Information: heat shock-related 70 kDa protein 2
• UniProt Protein Name: Heat shock-related 70 kDa protein 2
• Protein Family: Heat shock-related 70 kDa protein
• UniProt Gene Name: HSPA2
• UniProt Synonym Gene Names: Heat shock 70 kDa protein 2
• UniProt Entry Name: HSP72_HUMAN

Uniprot Description

HSPA2: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Interacts with ZNF541. Component of the CatSper complex. Belongs to the heat shock protein 70 family.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: cell surface; cytosol; male germ cell nucleus; membrane; mitochondrion; myelin sheath; nucleus; synaptonemal complex

Molecular Function: ATP binding; enzyme binding; glycolipid binding; protein binding; unfolded protein binding

Biological Process: G2/M-specific positive regulation of cyclin-dependent protein kinase activity; male meiosis; male meiosis I; protein refolding; response to cold; response to heat; response to unfolded protein; spermatid development; spermatogenesis