Mouse anti-Human BLM Monoclonal Antibody | anti-BLM antibody

BLM (Bloom Syndrome Protein, RecQ Protein-like 3, DNA Helicase, RecQ-like Type 2, RECQL3, RECQ2) APC

Cat. Num. AAA6135526

• Gene Names: BLM; BS; RECQ2; RECQL2; RECQL3
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: BLM; Monoclonal Antibody; BLM (Bloom Syndrome Protein; RecQ Protein-like 3; DNA Helicase; RecQ-like Type 2; RECQL3; RECQ2) APC; anti-BLM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1E4
• Specificity: Recognizes human BLM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-BLM antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1196-1295 from human BLM (NP_000048) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to BLM on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-BLM antibody

Antibodies; Disease Markers

NCBI and Uniprot Product Information

• NCBI GI #: 4557365
• NCBI GeneID: 641
• NCBI Accession #: NP_000048
• NCBI GenBank Nucleotide #: NM_000057
• UniProt Accession #: P54132; Q52M96
• Molecular Weight: 159,000 Da
• NCBI Official Full Name: Bloom syndrome protein isoform 1
• NCBI Official Synonym Full Names: Bloom syndrome, RecQ helicase-like
• NCBI Official Symbol: BLM
• NCBI Official Synonym Symbols: BS; RECQ2; RECQL2; RECQL3
• NCBI Protein Information: Bloom syndrome protein; DNA helicase, RecQ-like type 2; recQ protein-like 3
• UniProt Protein Name: Bloom syndrome protein
• Protein Family: Bloom syndrome protein
• UniProt Gene Name: BLM
• UniProt Synonym Gene Names: RECQ2; RECQL3; RecQ2
• UniProt Entry Name: BLM_HUMAN

Uniprot Description

BLM: a magnesium-dependent ATP-dependent DNA-helicase that unwinds single- and double-stranded DNA in a 3'-5' direction. A member of the RecQ helicase family that is required for genome stability. Participates in DNA replication, recombination and repair. Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50-MRE11-NBS1 protein complex which is a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts with ubiquitinated FANCD2.

Protein type: DNA repair, damage; DNA replication; Helicase; EC 3.6.4.12

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: male germ cell nucleus; nuclear chromosome; lateral element; chromosome, telomeric region; PML body; nuclear matrix; pronucleus; cytoplasm; nucleolus; replication fork; nucleus

Molecular Function: four-way junction helicase activity; G-quadruplex DNA binding; ATP-dependent DNA helicase activity; protein binding; ATP-dependent 3'-5' DNA helicase activity; p53 binding; ATPase activity; ATP-dependent helicase activity; bubble DNA binding; helicase activity; single-stranded DNA binding; ATP binding

Biological Process: negative regulation of DNA recombination; regulation of binding; positive regulation of transcription, DNA-dependent; negative regulation of mitotic recombination; DNA double-strand break processing; alpha-beta T cell differentiation; negative regulation of cell division; DNA repair; double-strand break repair via homologous recombination; DNA duplex unwinding; protein oligomerization; DNA recombination; replication fork processing; mitotic cell cycle G2/M transition DNA damage checkpoint; DNA strand renaturation; positive regulation of alpha-beta T cell proliferation; replication fork protection; regulation of cyclin-dependent protein kinase activity; response to DNA damage stimulus; telomere maintenance; response to X-ray

Disease: Bloom Syndrome