Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HSP90AB1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HSP90AB1 Polyclonal Antibody | anti-HSP90AB1 antibody

HSP90AB1 Antibody - middle region

Gene Names
HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HSP90AB1; Polyclonal Antibody; HSP90AB1 Antibody - middle region; anti-HSP90AB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEY
Sequence Length
724
Applicable Applications for anti-HSP90AB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HSP90AB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HSP90AB1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HSP90AB1Sample Tissue: Human A549 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSP90AB1 antibody
This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock protein and is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
Product Categories/Family for anti-HSP90AB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83 kDa
NCBI Official Full Name
heat shock protein HSP 90-beta isoform a
NCBI Official Synonym Full Names
heat shock protein 90 alpha family class B member 1
NCBI Official Symbol
HSP90AB1
NCBI Official Synonym Symbols
HSP84; HSPC2; HSPCB; D6S182; HSP90B
NCBI Protein Information
heat shock protein HSP 90-beta
UniProt Protein Name
Heat shock protein HSP 90-beta
Protein Family
UniProt Gene Name
HSP90AB1
UniProt Synonym Gene Names
HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84
UniProt Entry Name
HS90B_HUMAN

NCBI Description

This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock protein and is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes. [provided by RefSeq, Dec 2012]

Uniprot Description

HSP90B: Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function. Homodimer. Interacts with p53/TP53. Forms a complex with CDK6 and Hsp90/HSP90AB1. Interacts with UNC45A. Binding to UNC45A involves 2 UNC45A monomers per HSP90AB1 dimer. Interacts with CHORDC1 and DNAJC7. Interacts with FKBP4. Belongs to the heat shock protein 90 family.

Protein type: Chaperone; Heat shock protein

Chromosomal Location of Human Ortholog: 6p12

Cellular Component: nucleoplasm; signalosome; cell surface; membrane; mitochondrion; brush border membrane; basolateral plasma membrane; cytoplasm; apical plasma membrane; melanosome; inclusion body; cytosol

Molecular Function: protein binding; GTP binding; TPR domain binding; nitric-oxide synthase regulator activity; unfolded protein binding; double-stranded RNA binding; dATP binding; sulfonylurea receptor binding; kinase binding; protein kinase binding; ATP binding

Biological Process: axon guidance; positive regulation of nitric oxide biosynthetic process; protein folding; positive regulation of cell size; positive regulation of protein import into nucleus, translocation; positive regulation of protein binding; innate immune response; negative regulation of neuron apoptosis; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; response to unfolded protein; response to salt stress; placenta development

Research Articles on HSP90AB1

Similar Products

Product Notes

The HSP90AB1 hsp90ab1 (Catalog #AAA3223120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSP90AB1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSP90AB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSP90AB1 hsp90ab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KENYKKFYEA FSKNLKLGIH EDSTNRRRLS ELLRYHTSQS GDEMTSLSEY. It is sometimes possible for the material contained within the vial of "HSP90AB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.