Rabbit anti-Human HSFX1 Polyclonal Antibody | anti-HSFX1 antibody

HSFX1 (Heat Shock Transcription Factor, X-linked, LW-1, HSFX2, FLJ17347)

Cat. Num. AAA649169

• Gene Names: HSFX1; LW-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: HSFX1; Polyclonal Antibody; HSFX1 (Heat Shock Transcription Factor; X-linked; LW-1; HSFX2; FLJ17347); Anti -HSFX1 (Heat Shock Transcription Factor; anti-HSFX1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human HSFX1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST

• Applicable Applications for anti-HSFX1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human HSFX1, aa1-423 (NP_057237.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HSFX1 rabbit polyclonal antibody. Western Blot analysis of HSFX1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of HSFX1 expression in transfected 293T cell line by HSFX1 polyclonal antibody. Lane 1: HSFX1 transfected lysate (46.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-HSFX1 antibody

Located on chromosome X, this gene encodes hypothetical protein LOC51402.

Product Categories/Family for anti-HSFX1 antibody

Antibodies; Abs to Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 7706603
• NCBI GeneID: 100506164
• NCBI Accession #: NP_057237.1
• NCBI GenBank Nucleotide #: NM_016153.2
• UniProt Accession #: Q9UBD0
• Molecular Weight: 46,742 Da
• NCBI Official Full Name: heat shock transcription factor, X-linked
• NCBI Official Synonym Full Names: heat shock transcription factor family, X linked 1
• NCBI Official Symbol: HSFX1
• NCBI Official Synonym Symbols: LW-1
• NCBI Protein Information: heat shock transcription factor, X-linked
• UniProt Protein Name: Heat shock transcription factor, X-linked
• Protein Family: Heat shock transcription factor
• UniProt Gene Name: HSFX1
• UniProt Synonym Gene Names: LW-1
• UniProt Entry Name: HSFX1_HUMAN

Uniprot Description

Subcellular location: Nucleus

Potential. Cytoplasm Ref.4.

Tissue specificity: Testis-specific. Ref.4

Sequence similarities: Belongs to the HSF family.