Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (72.64kD).)

Mouse anti-Human HSFX1 Monoclonal Antibody | anti-HSFX1 antibody

HSFX1 (LW-1, Heat Shock Transcription Factor, X-linked, HSFX2)

Gene Names
HSFX1; LW-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HSFX1; Monoclonal Antibody; HSFX1 (LW-1; Heat Shock Transcription Factor; X-linked; HSFX2); Anti -HSFX1 (LW-1; anti-HSFX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D7
Specificity
Recognizes human LW-1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEDKRSLSMARCEERNSRGQDHGLERVPFPPQLQSETYLHPADPSPAWDDPGSTGSPNLRLLTEEIAFQPLAEEASFRRPHPDGDVPPQGEDNLLSLPFPQKLWRLVSSNQFSSIWWDDSGACRVINQKLFEKEILKRDVAHKVFATTSIKSFFRQLNLYGFRKRRQCTFRTFTRIFSAKRLVSILNKLEFYCHPYFQRDSPHLLVRMKRRVGVKSAPRHQEEDKPEAAGSCLAPADTEQQDHTSPNENDQVTPQHREPAGPNTQIRSGSAPPATPVMVPDSAVASDNSPVTQPAGEWSEGSQAHVTPVAAVPGPAALPFLYVPGSPTQMNSYGPVVALPTASRSTLAMDTTGLPAPGMLPFCHLWVPVTLVAAGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST
Applicable Applications for anti-HSFX1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-424 from human LW-1 (AAH21706) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (72.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (72.64kD).)

Western Blot (WB)

(LW-1 monoclonal antibody, Western Blot analysis of LW-1 expression in A-431.)

Western Blot (WB) (LW-1 monoclonal antibody, Western Blot analysis of LW-1 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged LW-1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LW-1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-HSFX1 antibody
Located on chromosome X, this gene encodes hypothetical protein LOC51402.
Product Categories/Family for anti-HSFX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,742 Da
NCBI Official Full Name
heat shock transcription factor, X-linked
NCBI Official Synonym Full Names
heat shock transcription factor family, X linked 1
NCBI Official Symbol
HSFX1
NCBI Official Synonym Symbols
LW-1
NCBI Protein Information
heat shock transcription factor, X-linked
UniProt Protein Name
Heat shock transcription factor, X-linked
UniProt Gene Name
HSFX1
UniProt Synonym Gene Names
LW-1
UniProt Entry Name
HSFX1_HUMAN

Uniprot Description

HSFX1: Belongs to the HSF family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: regulation of transcription, DNA-dependent; transcription, DNA-dependent

Similar Products

Product Notes

The HSFX1 hsfx1 (Catalog #AAA6001488) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSFX1 (LW-1, Heat Shock Transcription Factor, X-linked, HSFX2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HSFX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the HSFX1 hsfx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDKRSLSMA RCEERNSRGQ DHGLERVPFP PQLQSETYLH PADPSPAWDD PGSTGSPNLR LLTEEIAFQP LAEEASFRRP HPDGDVPPQG EDNLLSLPFP QKLWRLVSSN QFSSIWWDDS GACRVINQKL FEKEILKRDV AHKVFATTSI KSFFRQLNLY GFRKRRQCTF RTFTRIFSAK RLVSILNKLE FYCHPYFQRD SPHLLVRMKR RVGVKSAPRH QEEDKPEAAG SCLAPADTEQ QDHTSPNEND QVTPQHREPA GPNTQIRSGS APPATPVMVP DSAVASDNSP VTQPAGEWSE GSQAHVTPVA AVPGPAALPF LYVPGSPTQM NSYGPVVALP TASRSTLAMD TTGLPAPGML PFCHLWVPVT LVAAGAAQPA ASMVMFPHLP ALHHHCPHSH RTSQYMPASD GPQAYPDYAD QST. It is sometimes possible for the material contained within the vial of "HSFX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.