Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD polyclonal antibody. Lane 1: HPGD transfected lysate (29.37kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human HPGD Polyclonal Antibody | anti-HPGD antibody

HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+], 15-PGDH, Prostaglandin Dehydrogenase 1, PGDH1) (Biotin)

Gene Names
HPGD; PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HPGD; Polyclonal Antibody; HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+]; 15-PGDH; Prostaglandin Dehydrogenase 1; PGDH1) (Biotin); anti-HPGD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HPGD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HPGD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HPGD, aa1-266 (AAH18986.1).
Immunogen Sequence
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD polyclonal antibody. Lane 1: HPGD transfected lysate (29.37kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of HPGD expression in transfected 293T cell line by HPGD polyclonal antibody. Lane 1: HPGD transfected lysate (29.37kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-HPGD antibody
Prostaglandin inactivation. Contributes to the regulation of events that are under the control of prostaglandin levels. Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. Inhibits in vivo proliferation of colon cancer cells.
Product Categories/Family for anti-HPGD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
21,526 Da
NCBI Official Full Name
Homo sapiens hydroxyprostaglandin dehydrogenase 15-(NAD), mRNA
NCBI Official Synonym Full Names
hydroxyprostaglandin dehydrogenase 15-(NAD)
NCBI Official Symbol
HPGD
NCBI Official Synonym Symbols
PGDH; PGDH1; PHOAR1; 15-PGDH; SDR36C1
NCBI Protein Information
15-hydroxyprostaglandin dehydrogenase [NAD(+)]

NCBI Description

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on HPGD

Similar Products

Product Notes

The HPGD (Catalog #AAA6381641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HPGD (15-hydroxyprostaglandin Dehydrogenase [NAD+], 15-PGDH, Prostaglandin Dehydrogenase 1, PGDH1) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HPGD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HPGD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HPGD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.