Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Mouse EP300 Monoclonal Antibody | anti-EP300 antibody

EP300 (E1A Binding Protein p300, KAT3B, p300) (HRP)

Gene Names
EP300; p300; KAT3B; MKHK2; RSTS2
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
EP300; Monoclonal Antibody; EP300 (E1A Binding Protein p300; KAT3B; p300) (HRP); E1A Binding Protein p300; p300; anti-EP300 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1
Clone Number
1B1
Specificity
Recognizes EP300.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2414
Applicable Applications for anti-EP300 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EP300 (NP_001420, 731aa-830aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EP300 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EP300 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EP300 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EP300 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-EP300 antibody
References
1. p300 alters keratinocyte cell growth and differentiation through regulation of p21(Waf1/CIP1). Wong PP, Pickard A, McCance DJ.PLoS One. 2010 Jan 13;5(1):e8369.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
histone acetyltransferase p300 isoform 1
NCBI Official Synonym Full Names
E1A binding protein p300
NCBI Official Symbol
EP300
NCBI Official Synonym Symbols
p300; KAT3B; MKHK2; RSTS2
NCBI Protein Information
histone acetyltransferase p300
UniProt Protein Name
Histone acetyltransferase p300
UniProt Gene Name
EP300
UniProt Synonym Gene Names
P300; p300 HAT
UniProt Entry Name
EP300_HUMAN

NCBI Description

This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

p300: a histone acetyltransferase and transcriptional co-activator that regulates transcription via chromatin remodeling. Acetylates all four core histones in nucleosomes. Related to CPB (CREB-binding protein), and like CPB can stimulate transcription through activation of CREB. Specifically inhibited by the adenovirus oncoprotein E1A. A co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. Methylated at R580 and R604 in the KIX domain by CARM1, which blocks association with CREB, inhibits CREB signaling and activates the apoptotic response. Also methylated at R2142 by CARM1, which impairs interaction with NCoA2.

Protein type: Nuclear receptor co-regulator; EC 2.3.1.48; Acetyltransferase; Motility/polarity/chemotaxis; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus; histone acetyltransferase complex

Molecular Function: lysine N-acetyltransferase activity; transcription activator binding; zinc ion binding; p53 binding; chromatin DNA binding; transcription coactivator activity; beta-catenin binding; transcription factor binding; protein binding; histone acetyltransferase activity; DNA binding; androgen receptor binding; acetyltransferase activity; transferase activity, transferring acyl groups; chromatin binding; nuclear hormone receptor binding

Biological Process: circadian rhythm; establishment and/or maintenance of chromatin architecture; positive regulation of protein binding; viral reproduction; regulation of cell cycle; apoptosis; heart development; positive regulation of transcription of target genes involved in unfolded protein response; negative regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; positive regulation of interferon type I production; G2/M transition of mitotic cell cycle; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; nervous system development; Notch signaling pathway; skeletal muscle development; somitogenesis; internal peptidyl-lysine acetylation; transcription, DNA-dependent; protein stabilization; organ morphogenesis; protein amino acid acetylation; response to estrogen stimulus; response to hypoxia; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; mitotic cell cycle; internal protein amino acid acetylation; lung development; N-terminal peptidyl-lysine acetylation

Disease: Rubinstein-taybi Syndrome 2; Rubinstein-taybi Syndrome 1; Colorectal Cancer

Research Articles on EP300

Similar Products

Product Notes

The EP300 ep300 (Catalog #AAA6179215) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EP300 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EP300 ep300 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EP300, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.