Western Blot (WB)
(Host: RabbitTarget Name: HNRNPA2B1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse HNRNPA2B1 Polyclonal Antibody | anti-HNRNPA2B1 antibody
HNRNPA2B1 Antibody - C-terminal region
Gene Names
Hnrnpa2b1; Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
HNRNPA2B1; Polyclonal Antibody; HNRNPA2B1 Antibody - C-terminal region; anti-HNRNPA2B1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGG
Sequence Length
341
Applicable Applications for anti-HNRNPA2B1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse HNRNPA2B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HNRNPA2B1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HNRNPA2B1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HNRNPA2B1 antibody
Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm (By similarity). Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs (By similarity).
Product Categories/Family for anti-HNRNPA2B1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoproteins A2/B1 isoform 1
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A2/B1
NCBI Official Symbol
Hnrnpa2b1
NCBI Official Synonym Symbols
Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoproteins A2/B1
UniProt Protein Name
Heterogeneous nuclear ribonucleoproteins A2/B1
Protein Family
UniProt Gene Name
Hnrnpa2b1
UniProt Synonym Gene Names
Hnrpa2b1; hnRNP A2/B1
UniProt Entry Name
ROA2_MOUSE
Uniprot Description
hnRNP A2/B1: Involved with pre-mRNA processing. Forms complexes (ribonucleosomes) with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Identified in the spliceosome C complex. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Interacts with IGF2BP1. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA splicing; Spliceosome; RNA-binding
Cellular Component: cell soma; chromatin; cytoplasm; membrane; neuron projection; nucleoplasm; nucleus; perikaryon; ribonucleoprotein complex; spliceosome
Molecular Function: miRNA binding; mRNA 3'-UTR binding; nucleic acid binding; nucleotide binding; RNA binding; single-stranded telomeric DNA binding
Biological Process: mRNA export from nucleus; mRNA processing; negative regulation of nuclear mRNA splicing, via spliceosome; negative regulation of transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; primary microRNA processing; RNA splicing; RNA transport
Research Articles on HNRNPA2B1
Similar Products
Product Notes
The HNRNPA2B1 hnrnpa2b1 (Catalog #AAA3223632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPA2B1 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPA2B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HNRNPA2B1 hnrnpa2b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGYGNQGGGY GGGYDNYGGG NYGSGSYNDF GNYNQQPSNY GPMKSGNFGG. It is sometimes possible for the material contained within the vial of "HNRNPA2B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
