Rabbit HMGB2 Polyclonal Antibody | anti-HMGB2 antibody

Anti-HMGB2 Antibody

Cat. Num. AAA178502

• Gene Names: HMGB2; HMG2
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: HMGB2; Polyclonal Antibody; Anti-HMGB2 Antibody; C80539; HMG2; HMG-2; HMG 2; HMG B2; P26583; High mobility group protein B2; high mobility group box 2; anti-HMGB2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat; No cross reactivity with other proteins.
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized
• Sequence Length: 209

• Applicable Applications for anti-HMGB2 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5mug/ml; Tested Species: Human, Rat; Immunohistochemisry Paraffin: 0.5-1mug/ml; Tested Species: Human, Mouse, Rat; Tested Species:In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HMGB2 (65-97aa KSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR), identical to the related mouse and rat sequences.
• Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of HMGB2 expression in rat liver extract (lane 1) and human placenta extract (lane 2). HMGB2 at 24KD was detected using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(HMGB2 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB2 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(HMGB2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- HMGB2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-HMGB2 antibody

Rabbit IgG polyclonal antibody for High mobility group protein B2 (HMGB2) detection.
Background: High-mobility group protein B2, also known as high-mobility group protein 2 (HMG-2), is a protein that in humans is encoded by the HMGB2 gene. This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.

References

1. "Entrez Gene: HMGB2 high-mobility group box 2".
2. Majumdar A, Brown D, Kerby S, Rudzinski I, Polte T, Randhawa Z, Seidman MM (Dec 1991). "Sequence of human HMG2 cDNA". Nucleic Acids Research 19 (23): 6643.

NCBI and Uniprot Product Information

• NCBI GI #: 194688133
• NCBI GeneID: 3148
• NCBI Accession #: NP_001124160.1
• NCBI GenBank Nucleotide #: NM_001130688.1
• UniProt Accession #: P26583; Q5U072; B2R4K8; D3DP37
• Molecular Weight: 24,034 Da
• NCBI Official Full Name: high mobility group protein B2
• NCBI Official Synonym Full Names: high mobility group box 2
• NCBI Official Symbol: HMGB2
• NCBI Official Synonym Symbols: HMG2
• NCBI Protein Information: high mobility group protein B2
• UniProt Protein Name: High mobility group protein B2
• Protein Family: High mobility group protein
• UniProt Gene Name: HMGB2
• UniProt Synonym Gene Names: HMG2; HMG-2
• UniProt Entry Name: HMGB2_HUMAN

NCBI Description

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008]

Uniprot Description

HMGB2: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Belongs to the HMGB family.

Protein type: DNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 4q31

Cellular Component: cell; condensed chromosome; cytoplasm; extracellular space; nuclear chromatin; nucleolus; nucleoplasm; nucleus; perinuclear region of cytoplasm; protein complex

Molecular Function: chemoattractant activity; damaged DNA binding; DNA bending activity; DNA binding; double-stranded DNA binding; drug binding; four-way junction DNA binding; protein binding; RAGE receptor binding; single-stranded DNA binding; transcription factor activity; transcription factor binding

Biological Process: defense response to Gram-negative bacterium; defense response to Gram-positive bacterium; DNA fragmentation during apoptosis; DNA geometric change; DNA ligation during DNA repair; DNA topological change; inflammatory response to antigenic stimulus; negative regulation of transcription, DNA-dependent; positive regulation of DNA binding; positive regulation of endothelial cell proliferation; positive regulation of erythrocyte differentiation; positive regulation of megakaryocyte differentiation; positive regulation of nuclease activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of neurogenesis; regulation of transcription from RNA polymerase II promoter; response to drug; response to lipopolysaccharide; V(D)J recombination