Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 polyclonal antibody. Lane 1: HMGB2 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HMG2 Polyclonal Antibody | anti-HMG2 antibody

HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) APC

Gene Names
HMGB2; HMG2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HMG2; Polyclonal Antibody; HMG2 (High-mobility Group Box 2; High Mobility Group Protein B2; High Mobility Group Protein 2; HMG-2; HMGB2) APC; anti-HMG2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HMGB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HMG2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HMGB2, aa1-209 (NP_002120.1).
Immunogen Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 polyclonal antibody. Lane 1: HMGB2 transfected lysate (24kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 polyclonal antibody. Lane 1: HMGB2 transfected lysate (24kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HMG2 antibody
This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
Product Categories/Family for anti-HMG2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,034 Da
NCBI Official Full Name
high mobility group protein B2
NCBI Official Synonym Full Names
high mobility group box 2
NCBI Official Symbol
HMGB2
NCBI Official Synonym Symbols
HMG2
NCBI Protein Information
high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2
UniProt Protein Name
High mobility group protein B2
UniProt Gene Name
HMGB2
UniProt Synonym Gene Names
HMG2; HMG-2
UniProt Entry Name
HMGB2_HUMAN

NCBI Description

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008]

Uniprot Description

HMGB2: DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Belongs to the HMGB family.

Protein type: DNA-binding; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 4q31

Cellular Component: nucleoplasm; extracellular space; protein complex; perinuclear region of cytoplasm; cytoplasm; condensed chromosome; nucleus

Molecular Function: protein domain specific binding; RAGE receptor binding; protein binding; DNA binding; double-stranded DNA binding; damaged DNA binding; chromatin binding; DNA bending activity; transcription factor activity; single-stranded DNA binding; chemoattractant activity

Biological Process: positive regulation of nuclease activity; establishment and/or maintenance of chromatin architecture; DNA topological change; V(D)J recombination; apoptosis; positive regulation of transcription, DNA-dependent; positive regulation of erythrocyte differentiation; male gonad development; spermatid nuclear differentiation; base-excision repair, DNA ligation; regulation of transcription from RNA polymerase II promoter; chromatin remodeling; nucleosome assembly; positive chemotaxis; response to steroid hormone stimulus; DNA ligation during DNA repair; positive regulation of megakaryocyte differentiation; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; negative regulation of transcription, DNA-dependent; positive regulation of DNA binding; cell structure disassembly during apoptosis

Research Articles on HMG2

Similar Products

Product Notes

The HMG2 hmgb2 (Catalog #AAA6381343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HMG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMG2 hmgb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.