Rabbit anti-Human HLA-A Polyclonal Antibody | anti-HLA-A antibody

HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA) (Biotin)

Cat. Num. AAA6381212

• Gene Names: HLA-A; HLAA
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HLA-A; Polyclonal Antibody; HLA-A (HLA Class I Histocompatibility Antigen; A-3 alpha Chain; MHC Class I Antigen A*3; HLAA) (Biotin); anti-HLA-A antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human HLA-A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HLA-A antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human HLA-A, aa1-365 (NP_002107.3).
• Immunogen Sequence: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody. Lane 1: HLA-A transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-HLA-A antibody

Involved in the presentation of foreign antigens to the immune system.

Product Categories/Family for anti-HLA-A antibody

Antibodies; HLA

NCBI and Uniprot Product Information

• NCBI GI #: 24797067
• NCBI GeneID: 3105
• NCBI Accession #: NP_002107.3
• NCBI GenBank Nucleotide #: NM_002116
• UniProt Accession #: P04439; O19546; O19756; Q65A82; Q9GJE6; Q9GJE7; Q9GJE8; Q9MYE6; Q9MYG4; Q9TPR8; P01892; P13746; P18462; P30443; P30447; P30453; P30455; P30456; P30457; Q09160
• Molecular Weight: 40,841 Da
• NCBI Official Full Name: HLA class I histocompatibility antigen, A-1 alpha chain
• NCBI Official Synonym Full Names: major histocompatibility complex, class I, A
• NCBI Official Symbol: HLA-A
• NCBI Official Synonym Symbols: HLAA
• NCBI Protein Information: HLA class I histocompatibility antigen, A-1 alpha chain
• UniProt Protein Name: HLA class I histocompatibility antigen, A-3 alpha chain
• Protein Family: HLA class I histocompatibility antigen
• UniProt Gene Name: HLA-A
• UniProt Synonym Gene Names: HLAA
• UniProt Entry Name: 1A03_HUMAN

NCBI Description

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

HLAA iso3: Involved in the presentation of foreign antigens to the immune system. Belongs to the MHC class I family.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cell surface; early endosome membrane; endoplasmic reticulum; Golgi apparatus; Golgi medial cisterna; Golgi membrane; integral to plasma membrane; membrane; MHC class I protein complex; phagocytic vesicle membrane; plasma membrane

Molecular Function: beta-2-microglobulin binding; peptide antigen binding; protein binding; receptor binding; T cell receptor binding; TAP binding

Biological Process: antibacterial humoral response; antigen processing and presentation; antigen processing and presentation of endogenous peptide antigen via MHC class I; antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; defense response to Gram-positive bacterium; detection of bacterium; immune response; positive regulation of interferon-gamma production; positive regulation of T cell cytokine production; positive regulation of T cell mediated cytotoxicity; protection from natural killer cell mediated cytotoxicity; regulation of defense response to virus by virus; regulation of immune response; viral reproduction