Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody. Lane 1: HLA-A transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HLA-A Polyclonal Antibody | anti-HLA-A antibody

HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA) (AP)

Gene Names
HLA-A; HLAA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HLA-A; Polyclonal Antibody; HLA-A (HLA Class I Histocompatibility Antigen; A-3 alpha Chain; MHC Class I Antigen A*3; HLAA) (AP); anti-HLA-A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HLA-A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HLA-A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HLA-A, aa1-365 (NP_002107.3).
Immunogen Sequence
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody. Lane 1: HLA-A transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody. Lane 1: HLA-A transfected lysate (40.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HLA-A antibody
Involved in the presentation of foreign antigens to the immune system.
Product Categories/Family for anti-HLA-A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,841 Da
NCBI Official Full Name
HLA class I histocompatibility antigen, A-1 alpha chain
NCBI Official Synonym Full Names
major histocompatibility complex, class I, A
NCBI Official Symbol
HLA-A
NCBI Official Synonym Symbols
HLAA
NCBI Protein Information
HLA class I histocompatibility antigen, A-1 alpha chain
UniProt Protein Name
HLA class I histocompatibility antigen, A-3 alpha chain
UniProt Gene Name
HLA-A
UniProt Synonym Gene Names
HLAA
UniProt Entry Name
1A03_HUMAN

NCBI Description

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

HLAA iso3: Involved in the presentation of foreign antigens to the immune system. Belongs to the MHC class I family.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cell surface; early endosome membrane; endoplasmic reticulum; Golgi apparatus; Golgi medial cisterna; Golgi membrane; integral to plasma membrane; membrane; MHC class I protein complex; phagocytic vesicle membrane; plasma membrane

Molecular Function: beta-2-microglobulin binding; peptide antigen binding; protein binding; receptor binding; T cell receptor binding; TAP binding

Biological Process: antibacterial humoral response; antigen processing and presentation; antigen processing and presentation of endogenous peptide antigen via MHC class I; antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent; antigen processing and presentation of exogenous peptide antigen via MHC class I; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-independent; antigen processing and presentation of peptide antigen via MHC class I; cytokine and chemokine mediated signaling pathway; defense response to Gram-positive bacterium; detection of bacterium; immune response; positive regulation of interferon-gamma production; positive regulation of T cell cytokine production; positive regulation of T cell mediated cytotoxicity; protection from natural killer cell mediated cytotoxicity; regulation of defense response to virus by virus; regulation of immune response; viral reproduction

Research Articles on HLA-A

Similar Products

Product Notes

The HLA-A hla-a (Catalog #AAA6381210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-A (HLA Class I Histocompatibility Antigen, A-3 alpha Chain, MHC Class I Antigen A*3, HLAA) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLA-A hla-a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLA-A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.