Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP polyclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HHIP Polyclonal Antibody | anti-HHIP antibody

HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (AP)

Gene Names
HHIP; HIP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HHIP; Polyclonal Antibody; HHIP (Hedgehog-interacting Protein; HIP; UNQ5825/PRO19644; FLJ20992; FLJ90230) (AP); anti-HHIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HHIP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HHIP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HHIP, aa1-700 (NP_071920.1).
Immunogen Sequence
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP polyclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP polyclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HHIP antibody
Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.
Product Categories/Family for anti-HHIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,851 Da
NCBI Official Full Name
hedgehog-interacting protein
NCBI Official Synonym Full Names
hedgehog interacting protein
NCBI Official Symbol
HHIP
NCBI Official Synonym Symbols
HIP
NCBI Protein Information
hedgehog-interacting protein
UniProt Protein Name
Hedgehog-interacting protein
Protein Family
UniProt Gene Name
HHIP
UniProt Synonym Gene Names
HIP; HHIP; HIP
UniProt Entry Name
HHIP_HUMAN

NCBI Description

This gene encodes a member of the hedgehog-interacting protein (HHIP) family. The hedgehog (HH) proteins are evolutionarily conserved protein, which are important morphogens for a wide range of developmental processes, including anteroposterior patterns of limbs and regulation of left-right asymmetry in embryonic development. Multiple cell-surface receptors are responsible for transducing and/or regulating HH signals. The HHIP encoded by this gene is a highly conserved, vertebrate-specific inhibitor of HH signaling. It interacts with all three HH family members, SHH, IHH and DHH. Two single nucleotide polymorphisms (SNPs) near this gene are significantly associated with risk of chronic obstructive pulmonary disease (COPD). A single nucleotide polymorphism in this gene is also strongly associated with human height.[provided by RefSeq, Feb 2011]

Uniprot Description

HHIP: Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family. Belongs to the HHIP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q28-q32

Cellular Component: cell surface; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function: protein binding; oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor; zinc ion binding; quinone binding

Biological Process: smoothened signaling pathway; dorsal/ventral pattern formation; skeletal morphogenesis; negative regulation of smoothened signaling pathway; neuroblast proliferation; carbohydrate metabolic process; regulation of fibroblast growth factor receptor signaling pathway; negative regulation of signal transduction

Research Articles on HHIP

Similar Products

Product Notes

The HHIP hhip (Catalog #AAA6381089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HHIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HHIP hhip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HHIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.