Western Blot (WB)
(Host: RabbitTarget Name: HHATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Rabbit HHAT Polyclonal Antibody | anti-HHAT antibody
HHAT antibody - N-terminal region
Gene Names
HHAT; Skn; SKI1; MART2
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HHAT; Polyclonal Antibody; HHAT antibody - N-terminal region; anti-HHAT antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG
Sequence Length
493
Applicable Applications for anti-HHAT antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HHAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HHATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HHATSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HHATSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HHATSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-HHAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateHHAT is supported by BioGPS gene expression data to be expressed in HT1080)
Western Blot (WB)
(WB Suggested Anti-HHAT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysateHHAT is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-HHAT antibody
This is a rabbit polyclonal antibody against HHAT. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).
Target Description: Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).
Product Categories/Family for anti-HHAT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
protein-cysteine N-palmitoyltransferase HHAT isoform 1
NCBI Official Synonym Full Names
hedgehog acyltransferase
NCBI Official Symbol
HHAT
NCBI Official Synonym Symbols
Skn; SKI1; MART2
NCBI Protein Information
protein-cysteine N-palmitoyltransferase HHAT
UniProt Protein Name
Protein-cysteine N-palmitoyltransferase HHAT
Protein Family
UniProt Gene Name
HHAT
UniProt Synonym Gene Names
MART2; SKI1; MART-2
UniProt Entry Name
HHAT_HUMAN
NCBI Description
'Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725).[supplied by OMIM, Jul 2002]
Research Articles on HHAT
Similar Products
Product Notes
The HHAT hhat (Catalog #AAA3208558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HHAT antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HHAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HHAT hhat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLPRWELALY LLASLGFHFY SFYEVYKVSR EHEEELDQEF ELETDTLFGG. It is sometimes possible for the material contained within the vial of "HHAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
