Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Hex Picoband antibody, MBS178143, Western blottingAll lanes: Anti Hex (MBS178143) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 47KD)

Hex Polyclonal Antibody | anti-Hex antibody

Anti-Hex Antibody

Gene Names
HHEX; HEX; PRH; HMPH; PRHX; HOX11L-PEN
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hex; Polyclonal Antibody; Anti-Hex Antibody; Hematopoietically-expressed homeobox protein Hhex; Hematopoietically expressed homeobox; Hematopoietically-expressed homeobox protein HHEX; HEX; HHEX; HHEX_HUMAN; HMPH; Homeobox hematopoietically expressed; Homeobox protein HEX; Homeobox protein PRH; HOX11L PEN; PRH; PRHX; Proline rich homeodomain containing transcription factor; OTTHUMP00000206478; OTTHUMP00000206479; OTTHUMP00000206480; OTTHUMP00000206482; OTTHUMP00000207360; USURPIN; Usurpin beta; hematopoietically expressed homeobox; anti-Hex antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
270
Applicable Applications for anti-Hex antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Hex Picoband antibody, MBS178143, Western blottingAll lanes: Anti Hex (MBS178143) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 47KD)

Western Blot (WB) (Anti- Hex Picoband antibody, MBS178143, Western blottingAll lanes: Anti Hex (MBS178143) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: HEPG Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 47KD)
Related Product Information for anti-Hex antibody
Description: Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human;Mouse; Rat.

Background: Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.'s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
References
1. D'Elia, A. V., Tell, G., Russo, D., Arturi, F., Puglisi, F., Manfioletti, G., Gattei, V., Mack, D. L., Cataldi, P., Filetti, S., Di Loreto, C., Damante, G. Expression and localization of the homeodomain-containing protein HEX in human thyroid tumors. J. Clin. Endocr. Metab. 87: 1376-1383, 2002. 2. Hromas, R., Radich, J., Collins, S. PCR cloning of an orphan homeobox gene (PRH) preferentially expressed in myeloid and liver cells. Biochem. Biophys. Res. Commun. 195: 976-983, 1993.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,022 Da
NCBI Official Full Name
hematopoietically-expressed homeobox protein HHEX
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
HHEX
NCBI Official Synonym Symbols
HEX; PRH; HMPH; PRHX; HOX11L-PEN
NCBI Protein Information
hematopoietically-expressed homeobox protein HHEX
UniProt Protein Name
Hematopoietically-expressed homeobox protein HHEX
Protein Family
UniProt Gene Name
HHEX
UniProt Synonym Gene Names
HEX; PRH; PRHX; Homeobox protein HEX
UniProt Entry Name
HHEX_HUMAN

NCBI Description

This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: cytoplasm; nucleus

Molecular Function: chromatin binding; DNA bending activity; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; TATA-binding protein binding; transcription factor binding

Biological Process: anterior/posterior pattern formation; B cell differentiation; cell differentiation; cell proliferation; embryonic heart tube development; endoderm development; forebrain morphogenesis; in utero embryonic development; interkinetic nuclear migration; mRNA export from nucleus; multicellular organism growth; myeloid leukocyte differentiation; negative regulation of angiogenesis; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of vascular endothelial growth factor receptor signaling pathway; Notch signaling pathway; pancreas development; poly(A)+ mRNA export from nucleus; positive regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; regulation of cell proliferation; thyroid gland development; transcription, DNA-dependent; vasculogenesis; Wnt receptor signaling pathway

Research Articles on Hex

Similar Products

Product Notes

The Hex hhex (Catalog #AAA178143) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hex Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hex can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the Hex hhex for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hex, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.