Western Blot (WB)
(Host: RabbitTarget Name: HES1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse HES1 Polyclonal Antibody | anti-HES1 antibody
HES1 Antibody - N-terminal region
Gene Names
Hes1; Hry; bHLHb39
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
HES1; Polyclonal Antibody; HES1 Antibody - N-terminal region; anti-HES1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQL
Sequence Length
282
Applicable Applications for anti-HES1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse HES1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HES1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HES1Sample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HES1 antibody
Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1 (By similarity). Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity).
Product Categories/Family for anti-HES1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
transcription factor HES-1
NCBI Official Synonym Full Names
hes family bHLH transcription factor 1
NCBI Official Symbol
Hes1
NCBI Official Synonym Symbols
Hry; bHLHb39
NCBI Protein Information
transcription factor HES-1
UniProt Protein Name
Transcription factor HES-1
Protein Family
UniProt Gene Name
Hes1
UniProt Synonym Gene Names
Hes-1
UniProt Entry Name
HES1_MOUSE
Research Articles on HES1
Similar Products
Product Notes
The HES1 hes1 (Catalog #AAA3223578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HES1 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HES1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HES1 hes1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNSSSPVAAT PASVNTTPDK PKTASEHRKS SKPIMEKRRR ARINESLSQL. It is sometimes possible for the material contained within the vial of "HES1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
