Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HCRTR1Antibody Dilution: 1.0ug/mlSample Type: Human brain)

Rabbit HCRTR1 Polyclonal Antibody | anti-HCRTR1 antibody

HCRTR1 antibody - C-terminal region

Gene Names
HCRTR1; OX1R
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HCRTR1; Polyclonal Antibody; HCRTR1 antibody - C-terminal region; anti-HCRTR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYL
Sequence Length
425
Applicable Applications for anti-HCRTR1 antibody
Western Blot (WB)
Homology
Horse: 83%; Human: 100%; Rabbit: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HCRTR1Antibody Dilution: 1.0ug/mlSample Type: Human brain)

Western Blot (WB) (Host: RabbitTarget Name: HCRTR1Antibody Dilution: 1.0ug/mlSample Type: Human brain)
Related Product Information for anti-HCRTR1 antibody
This is a rabbit polyclonal antibody against HCRTR1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B.
Product Categories/Family for anti-HCRTR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
orexin receptor type 1
NCBI Official Synonym Full Names
hypocretin receptor 1
NCBI Official Symbol
HCRTR1
NCBI Official Synonym Symbols
OX1R
NCBI Protein Information
orexin receptor type 1
UniProt Protein Name
Orexin receptor type 1
Protein Family
UniProt Gene Name
HCRTR1
UniProt Synonym Gene Names
Ox-1-R; Ox1-R; Ox1R
UniProt Entry Name
OX1R_HUMAN

NCBI Description

The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq, Jan 2009]

Uniprot Description

HCRTR1: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Seems to be exclusively coupled to the G(q) subclass of heteromeric G proteins, which activates the phospholipase C mediated signaling cascade. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p33

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; neuropeptide receptor activity; orexin receptor activity; peptide hormone binding; peptide binding

Biological Process: synaptic transmission; neuropeptide signaling pathway; feeding behavior; cellular response to hormone stimulus; regulation of circadian sleep/wake cycle, sleep

Research Articles on HCRTR1

Similar Products

Product Notes

The HCRTR1 hcrtr1 (Catalog #AAA3216733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCRTR1 antibody - C-terminal region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's HCRTR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HCRTR1 hcrtr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQLGDLEQGL SGEPQPRARA FLAEVKQMRA RRKTAKMLMV VLLVFALCYL. It is sometimes possible for the material contained within the vial of "HCRTR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.