Western Blot (WB)
(Western Blot analysis of HAPLN1 expression in transfected 293T cell line by MBS641868. Lane 1: HAPLN1 transfected lysate (39.05kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human HAPLN1 Polyclonal Antibody | anti-HAPLN1 antibody
HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1, Cartilage-linking Protein 1, Cartilage-link Protein, Proteoglycan Link Protein, CRTL1)
Gene Names
HAPLN1; CRTL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
HAPLN1; Polyclonal Antibody; HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1; Cartilage-linking Protein 1; Cartilage-link Protein; Proteoglycan Link Protein; CRTL1); Anti -HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1; anti-HAPLN1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HAPLN1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDVAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Applicable Applications for anti-HAPLN1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human HAPLN1, aa1-354 (AAH57808).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of HAPLN1 expression in transfected 293T cell line by MBS641868. Lane 1: HAPLN1 transfected lysate (39.05kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HAPLN1 expression in transfected 293T cell line by MBS641868. Lane 1: HAPLN1 transfected lysate (39.05kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HAPLN1 antibody
Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
Product Categories/Family for anti-HAPLN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,166 Da
NCBI Official Full Name
hyaluronan and proteoglycan link protein 1
NCBI Official Synonym Full Names
hyaluronan and proteoglycan link protein 1
NCBI Official Symbol
HAPLN1
NCBI Official Synonym Symbols
CRTL1
NCBI Protein Information
hyaluronan and proteoglycan link protein 1; Cartilage link protein; cartilage-link protein; cartilage linking protein 1; cartilage-linking protein 1
UniProt Protein Name
Hyaluronan and proteoglycan link protein 1
Protein Family
UniProt Gene Name
HAPLN1
UniProt Synonym Gene Names
CRTL1; Cartilage-link protein
UniProt Entry Name
HPLN1_HUMAN
Uniprot Description
HAPLN1: Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix. Belongs to the HAPLN family.
Protein type: Extracellular matrix
Chromosomal Location of Human Ortholog: 5q14.3
Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular region
Molecular Function: extracellular matrix structural constituent; hyaluronic acid binding
Biological Process: extracellular matrix organization and biogenesis; central nervous system development; cell adhesion; skeletal development
Research Articles on HAPLN1
Similar Products
Product Notes
The HAPLN1 hapln1 (Catalog #AAA641868) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1, Cartilage-linking Protein 1, Cartilage-link Protein, Proteoglycan Link Protein, CRTL1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAPLN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HAPLN1 hapln1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKSLLLLVLI SICWADHLSD NYTLDHDRAI HIQAENGPHL LVEAEQAKVF SHRGGNVTLP CKFYRDPTAF GSGIHKIRIK WTKLTSDYLK EVDVFVSMGY HKKTYGGYQG RVFLKGGSDS DASLVITDLT LEDYGRYKCE VIEGLEDDTV VVALDLQGVV FPYFPRLGRY NLNFHEAQQA CLDQDAVIAS FDQLYDAWRG GLDWCNAGWL SDGSVQYPIT KPREPCGGQN TVPGVRNYGF WDKDKSRYDV FCFTSNFNGR FYYLIHPTKL TYDVAVQACL NDGAQIAKVG QIFAAWKILG YDRCDAGWLA DGSVRYPISR PRRRCSPTEA AVRFVGFPDK KHKLYGVYCF RAYN. It is sometimes possible for the material contained within the vial of "HAPLN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
