Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GSTM5 expression in transfected 293T cell line by GSTM5 polyclonal antibody. Lane 1: GSTM5 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human, Mouse GSTM5 Polyclonal Antibody | anti-GSTM5 antibody

GSTM5 (Glutathione S-Transferase Mu 5, GST class-mu 5, GSTM5-5, GTM5) (FITC)

Gene Names
GSTM5; GTM5; GSTM5-5
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GSTM5; Polyclonal Antibody; GSTM5 (Glutathione S-Transferase Mu 5; GST class-mu 5; GSTM5-5; GTM5) (FITC); anti-GSTM5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GSTM5. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-GSTM5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GSTM5, aa1-218 (NP_000842.2).
Immunogen Sequence
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GSTM5 expression in transfected 293T cell line by GSTM5 polyclonal antibody. Lane 1: GSTM5 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GSTM5 expression in transfected 293T cell line by GSTM5 polyclonal antibody. Lane 1: GSTM5 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-GSTM5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,675 Da
NCBI Official Full Name
glutathione S-transferase Mu 5
NCBI Official Synonym Full Names
glutathione S-transferase mu 5
NCBI Official Symbol
GSTM5
NCBI Official Synonym Symbols
GTM5; GSTM5-5
NCBI Protein Information
glutathione S-transferase Mu 5; GST class-mu 5; S-(hydroxyalkyl)glutathione lyase M5; glutathione S-alkyltransferase M5; glutathione S-aralkyltransferase M5; glutathione S-aryltransferase M5; glutathione S-transferase M5
UniProt Protein Name
Glutathione S-transferase Mu 5
Protein Family
UniProt Gene Name
GSTM5
UniProt Entry Name
GSTM5_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTM5: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Belongs to the GST superfamily. Mu family.

Protein type: Transferase; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: cytosol

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process

Research Articles on GSTM5

Similar Products

Product Notes

The GSTM5 gstm5 (Catalog #AAA6380421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTM5 (Glutathione S-Transferase Mu 5, GST class-mu 5, GSTM5-5, GTM5) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GSTM5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTM5 gstm5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTM5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.