Rabbit anti-Human, Mouse GSTM5 Polyclonal Antibody | anti-GSTM5 antibody

GSTM5 (Glutathione S-Transferase Mu 5, GST class-mu 5, GSTM5-5, GTM5) (Biotin)

Cat. Num. AAA6380420

• Gene Names: GSTM5; GTM5; GSTM5-5
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTM5; Polyclonal Antibody; GSTM5 (Glutathione S-Transferase Mu 5; GST class-mu 5; GSTM5-5; GTM5) (Biotin); anti-GSTM5 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTM5. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GSTM5 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTM5, aa1-218 (NP_000842.2).
• Immunogen Sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GSTM5 expression in transfected 293T cell line by GSTM5 polyclonal antibody. Lane 1: GSTM5 transfected lysate (25.7kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-GSTM5 antibody

Antibodies; GST

NCBI and Uniprot Product Information

• NCBI GI #: 23065563
• NCBI GeneID: 2949
• NCBI Accession #: NP_000842.2
• NCBI GenBank Nucleotide #: NM_000851.2
• UniProt Accession #: P46439; Q6PD78; A8K0V8
• Molecular Weight: 25,675 Da
• NCBI Official Full Name: glutathione S-transferase Mu 5
• NCBI Official Synonym Full Names: glutathione S-transferase mu 5
• NCBI Official Symbol: GSTM5
• NCBI Official Synonym Symbols: GTM5; GSTM5-5
• NCBI Protein Information: glutathione S-transferase Mu 5; GST class-mu 5; S-(hydroxyalkyl)glutathione lyase M5; glutathione S-alkyltransferase M5; glutathione S-aralkyltransferase M5; glutathione S-aryltransferase M5; glutathione S-transferase M5
• UniProt Protein Name: Glutathione S-transferase Mu 5
• Protein Family: Glutathione S-transferase
• UniProt Gene Name: GSTM5
• UniProt Entry Name: GSTM5_HUMAN

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Diversification of these genes has occurred in regions encoding substrate-binding domains, as well as in tissue expression patterns, to accommodate an increasing number of foreign compounds. [provided by RefSeq, Jul 2008]

Uniprot Description

GSTM5: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Belongs to the GST superfamily. Mu family.

Protein type: Transferase; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 2.5.1.18

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: cytosol

Molecular Function: glutathione transferase activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process