Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit GSTK1 Polyclonal Antibody | anti-GSTK1 antibody

GSTK1 antibody - N-terminal region

Gene Names
GSTK1; GST; GST13; hGSTK1; GSTK1-1; GST13-13; GST 13-13
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GSTK1; Polyclonal Antibody; GSTK1 antibody - N-terminal region; anti-GSTK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK
Sequence Length
226
Applicable Applications for anti-GSTK1 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GSTK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-GSTK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-GSTK1 antibody
This is a rabbit polyclonal antibody against GSTK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
Product Categories/Family for anti-GSTK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
glutathione S-transferase kappa 1 isoform a
NCBI Official Synonym Full Names
glutathione S-transferase kappa 1
NCBI Official Symbol
GSTK1
NCBI Official Synonym Symbols
GST; GST13; hGSTK1; GSTK1-1; GST13-13; GST 13-13
NCBI Protein Information
glutathione S-transferase kappa 1
UniProt Protein Name
Glutathione S-transferase kappa 1
Protein Family
UniProt Gene Name
GSTK1
UniProt Synonym Gene Names
hGSTK1
UniProt Entry Name
GSTK1_HUMAN

NCBI Description

This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009]

Uniprot Description

GSTK1: Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB). Belongs to the GST superfamily. Kappa family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.5.1.18; Xenobiotic Metabolism - metabolism by cytochrome P450; Other Amino Acids Metabolism - glutathione; Transferase; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: membrane; intracellular membrane-bound organelle; mitochondrial matrix; mitochondrial inner membrane; peroxisome; intracellular

Molecular Function: glutathione transferase activity; protein disulfide oxidoreductase activity; glutathione peroxidase activity; receptor binding

Biological Process: glutathione metabolic process; epithelial cell differentiation

Research Articles on GSTK1

Similar Products

Product Notes

The GSTK1 gstk1 (Catalog #AAA3212167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSTK1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GSTK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSTK1 gstk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLQLRPSLIT GIMKDSGNKP PGLLPRKGLY MANDLKLLRH HLQIPIHFPK. It is sometimes possible for the material contained within the vial of "GSTK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.