Western Blot (WB)
(Host: RabbitTarget Name: GSRSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse GSR Polyclonal Antibody | anti-GSR antibody
GSR Antibody - middle region
Gene Names
Gsr; Gr1; Gr-1; AI325518; D8Ertd238e
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
GSR; Polyclonal Antibody; GSR Antibody - middle region; anti-GSR antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYG
Sequence Length
500
Applicable Applications for anti-GSR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse GSR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GSRSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GSRSample Tissue: Mouse Small Intestine lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GSR antibody
Maintains high levels of reduced glutathione in the cytosol.
Product Categories/Family for anti-GSR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
glutathione reductase, mitochondrial
NCBI Official Synonym Full Names
glutathione reductase
NCBI Official Symbol
Gsr
NCBI Official Synonym Symbols
Gr1; Gr-1; AI325518; D8Ertd238e
NCBI Protein Information
glutathione reductase, mitochondrial
UniProt Protein Name
Glutathione reductase, mitochondrial
Protein Family
UniProt Gene Name
Gsr
UniProt Synonym Gene Names
Gr1; GR; GRase
UniProt Entry Name
GSHR_MOUSE
Uniprot Description
GSR: a class-I pyridine nucleotide-disulfide oxidoreductase. Maintains high levels of reduced glutathione in the cytosol. Alternative initiation results in a mitochondrial and a cytoplasmic isoform.
Protein type: Other Amino Acids Metabolism - glutathione; EC 1.8.1.7; Oxidoreductase
Cellular Component: cytoplasm; cytosol; external side of plasma membrane; mitochondrion
Molecular Function: FAD binding; glutathione binding; glutathione-disulfide reductase activity; NADP binding; oxidoreductase activity; oxidoreductase activity, acting on sulfur group of donors, NAD or NADP as acceptor; protein homodimerization activity
Biological Process: cell redox homeostasis; glutathione metabolic process; spermatogenesis
Research Articles on GSR
Similar Products
Product Notes
The GSR gsr (Catalog #AAA3223627) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSR Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GSR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSR gsr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAAGRKLAHR LFECKQDSKL DYDNIPTVVF SHPPIGTVGL TEDEAVHKYG. It is sometimes possible for the material contained within the vial of "GSR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
