Western Blot (WB)
(WB Suggested Anti-GSH2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: LN18 cell lysate)
Rabbit GSH2 Polyclonal Antibody | anti-GSX2 antibody
GSH2 antibody - C-terminal region
Gene Names
GSX2; GSH2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GSH2; Polyclonal Antibody; GSH2 antibody - C-terminal region; anti-GSX2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKG
Sequence Length
304
Applicable Applications for anti-GSX2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GSH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GSH2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: LN18 cell lysate)
Western Blot (WB)
(WB Suggested Anti-GSH2 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: LN18 cell lysate)
Related Product Information for anti-GSX2 antibody
This is a rabbit polyclonal antibody against GSH2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: homeobox protein GSH-2
Target Description: homeobox protein GSH-2
Product Categories/Family for anti-GSX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
GS homeobox 2
NCBI Official Synonym Full Names
GS homeobox 2
NCBI Official Symbol
GSX2
NCBI Official Synonym Symbols
GSH2
NCBI Protein Information
GS homeobox 2
UniProt Protein Name
GS homeobox 2
Protein Family
UniProt Gene Name
GSX2
UniProt Synonym Gene Names
GSH2
Uniprot Description
During telencephalic development, causes ventralization of pallial progenitors and, depending on the developmental stage, specifies different neuronal fates. At early stages, necessary and sufficient to correctly specify the ventral lateral ganglionic eminence (LGE) and its major derivatives, the striatal projection neurons. At later stages, may specify LGE progenitors toward dorsal LGE fates, including olfactory bulb interneurons (). Transcription factor that binds 5'-CNAATTAG-3' DNA sequence.
Research Articles on GSX2
Similar Products
Product Notes
The GSX2 gsx2 (Catalog #AAA3204885) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSH2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GSH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSX2 gsx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLELEREFSS NMYLSRLRRI EIATYLNLSE KQVKIWFQNR RVKHKKEGKG. It is sometimes possible for the material contained within the vial of "GSH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
