Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GRK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit GRK7 Polyclonal Antibody | anti-GRK7 antibody

GRK7 antibody - C-terminal region

Gene Names
GRK7; GPRK7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRK7; Polyclonal Antibody; GRK7 antibody - C-terminal region; anti-GRK7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL
Sequence Length
553
Applicable Applications for anti-GRK7 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GRK7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GRK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-GRK7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-GRK7 antibody
This is a rabbit polyclonal antibody against GRK7. It was validated on Western Blot

Target Description: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
rhodopsin kinase
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 7
NCBI Official Symbol
GRK7
NCBI Official Synonym Symbols
GPRK7
NCBI Protein Information
rhodopsin kinase
UniProt Protein Name
G protein-coupled receptor kinase 7
Protein Family
UniProt Gene Name
GRK7
UniProt Synonym Gene Names
GPRK7
UniProt Entry Name
GRK7_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation. [provided by RefSeq, Jul 2008]

Uniprot Description

GRK7: Retina-specific kinase involved in the shutoff of the photoresponse and adaptation to changing light conditions via cone opsin phosphorylation, including rhodopsin (RHO). Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily.

Protein type: EC 2.7.11.14; Kinase, protein; Protein kinase, AGC; EC 2.7.11.16; Protein kinase, Ser/Thr (non-receptor); AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 3q24

Cellular Component: membrane

Molecular Function: G-protein coupled receptor kinase activity; rhodopsin kinase activity; ATP binding

Biological Process: visual perception; protein amino acid autophosphorylation; signal transduction

Research Articles on GRK7

Similar Products

Product Notes

The GRK7 grk7 (Catalog #AAA3214526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRK7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRK7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRK7 grk7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFKNFATGAV PIAWQEEIIE TGLFEELNDP NRPTGCEEGN SSKSGVCLLL. It is sometimes possible for the material contained within the vial of "GRK7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.