Western Blot (WB)
(WB Suggested Anti-GRIPAP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Rabbit GRIPAP1 Polyclonal Antibody | anti-GRIPAP1 antibody
GRIPAP1 antibody - N-terminal region
Gene Names
GRIPAP1; GRASP-1
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRIPAP1; Polyclonal Antibody; GRIPAP1 antibody - N-terminal region; anti-GRIPAP1 antibody
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEV
Sequence Length
841
Applicable Applications for anti-GRIPAP1 antibody
Western Blot (WB)
Homology
Cow: 92%; Human: 100%; Pig: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIPAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GRIPAP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-GRIPAP1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-GRIPAP1 antibody
This is a rabbit polyclonal antibody against GRIPAP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.
Target Description: This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.
Product Categories/Family for anti-GRIPAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
GRIP1-associated protein 1
NCBI Official Synonym Full Names
GRIP1 associated protein 1
NCBI Official Symbol
GRIPAP1
NCBI Official Synonym Symbols
GRASP-1
NCBI Protein Information
GRIP1-associated protein 1
UniProt Protein Name
GRIP1-associated protein 1
Protein Family
UniProt Gene Name
GRIPAP1
UniProt Synonym Gene Names
KIAA1167; GRASP-1
UniProt Entry Name
GRAP1_HUMAN
NCBI Description
This gene encodes a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). The encoded protein interacts in a complex with glutamate receptor interacting protein 1 (GRIP1) and plays a role in the regulation of AMPA receptor function. [provided by RefSeq, Aug 2013]
Uniprot Description
GRIPAP1: a guanine nucleotide exchange factor for the Ras family of small G proteins (RasGEF). In brain studies, the encoded protein was found with the GRIP/AMPA receptor complex. Multiple alternatively spliced transcript variants have been described that encode different protein isoforms; however, the full-length nature and biological validity of all of these variants have not been determined.[provided by RefSeq, Nov 2009]
Protein type: GEFs, Ras; GEFs
Chromosomal Location of Human Ortholog: Xp11.23
Cellular Component: early endosome
Research Articles on GRIPAP1
Similar Products
Product Notes
The GRIPAP1 gripap1 (Catalog #AAA3213319) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIPAP1 antibody - N-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's GRIPAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRIPAP1 gripap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENTALQKNVA ALQERYGKEA GKFSAVSEGQ GDPPGGPAPT VLAPMPLAEV. It is sometimes possible for the material contained within the vial of "GRIPAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
