Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GRHPRSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GRHPR Polyclonal Antibody | anti-GRHPR antibody

GRHPR Antibody - N-terminal region

Gene Names
GRHPR; PH2; GLXR; GLYD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GRHPR; Polyclonal Antibody; GRHPR Antibody - N-terminal region; anti-GRHPR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDK
Sequence Length
328
Applicable Applications for anti-GRHPR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRHPR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GRHPRSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GRHPRSample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GRHPR antibody
This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene.
Product Categories/Family for anti-GRHPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
glyoxylate reductase/hydroxypyruvate reductase
NCBI Official Synonym Full Names
glyoxylate and hydroxypyruvate reductase
NCBI Official Symbol
GRHPR
NCBI Official Synonym Symbols
PH2; GLXR; GLYD
NCBI Protein Information
glyoxylate reductase/hydroxypyruvate reductase
UniProt Protein Name
Glyoxylate reductase/hydroxypyruvate reductase
UniProt Gene Name
GRHPR
UniProt Synonym Gene Names
GLXR
UniProt Entry Name
GRHPR_HUMAN

NCBI Description

This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GRHPR: Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate. Defects in GRHPR are the cause of hyperoxaluria primary type 2 (HP2); also known as primary hyperoxaluria type II (PH2). HP2 is a disorder where the main clinical manifestation is calcium oxalate nephrolithiasis though chronic as well as terminal renal insufficiency has been described. It is characterized by an elevated urinary excretion of oxalate and L- glycerate. Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.

Protein type: Carbohydrate Metabolism - glyoxylate and dicarboxylate; Carbohydrate Metabolism - pyruvate; Oxidoreductase; EC 1.1.1.79; EC 1.1.1.81

Chromosomal Location of Human Ortholog: 9q12

Cellular Component: peroxisomal matrix; cytoplasm; cytosol

Molecular Function: glyoxylate reductase (NADP) activity; protein homodimerization activity; carboxylic acid binding; hydroxypyruvate reductase activity; NAD binding; glycerate dehydrogenase activity

Biological Process: dicarboxylic acid metabolic process; glyoxylate metabolic process; metabolic process; excretion; protein oligomerization

Disease: Hyperoxaluria, Primary, Type Ii

Research Articles on GRHPR

Similar Products

Product Notes

The GRHPR grhpr (Catalog #AAA3221918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRHPR Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRHPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRHPR grhpr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAEGRVALAR AADCEVEQWD SDEPIPAKEL ERGVAGAHGL LCLLSDHVDK. It is sometimes possible for the material contained within the vial of "GRHPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.