Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit GPRC6A Polyclonal Antibody | anti-GPRC6A antibody

GPRC6A Antibody - N-terminal region

Gene Names
GPRC6A; GPCR; bA86F4.3
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPRC6A; Polyclonal Antibody; GPRC6A Antibody - N-terminal region; anti-GPRC6A antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
Sequence Length
926
Applicable Applications for anti-GPRC6A antibody
Western Blot (WB)
Homology
Dog: 77%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 79%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPRC6ASample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GPRC6ASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GPRC6A AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Related Product Information for anti-GPRC6A antibody
This is a rabbit polyclonal antibody against GPRC6A. It was validated on Western Blot

Target Description: Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain.
Product Categories/Family for anti-GPRC6A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
G-protein coupled receptor family C group 6 member A isoform 1
NCBI Official Synonym Full Names
G protein-coupled receptor class C group 6 member A
NCBI Official Symbol
GPRC6A
NCBI Official Synonym Symbols
GPCR; bA86F4.3
NCBI Protein Information
G-protein coupled receptor family C group 6 member A
UniProt Protein Name
G-protein coupled receptor family C group 6 member A
UniProt Gene Name
GPRC6A
UniProt Synonym Gene Names
hGPRC6A; hGPCR33
UniProt Entry Name
GPC6A_HUMAN

NCBI Description

Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain (summary by Pi et al., 2005 [PubMed 16199532]).[supplied by OMIM, Nov 2010]

Uniprot Description

GPRC6A: Receptor activated by amino acids with a preference for basic amino acids such as L-Lys, L-Arg and L-ornithine but also by small and polar amino acids. The L-alpha amino acids respond is augmented by divalent cations Ca(2+) and Mg(2+). Activated by extracellular calcium and osteocalin. Seems to act through a G(q)/G(11) and G(i)-coupled pathway. Mediates the non-genomic effects of androgens in multiple tissue. May coordinates nutritional and hormonal anabolic signals through the sensing of extracellular amino acids, osteocalcin, divalents ions and its responsiveness to anabolic steroids. Belongs to the G-protein coupled receptor 3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 3; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q22.1

Cellular Component: cell surface; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; calcium-mediated signaling; response to amino acid stimulus

Research Articles on GPRC6A

Similar Products

Product Notes

The GPRC6A gprc6a (Catalog #AAA3216421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPRC6A Antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPRC6A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPRC6A gprc6a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQPCQTPDDF VAATSPGHII IGGLFAIHEK MLSSEDSPRR PQIQECVGFE. It is sometimes possible for the material contained within the vial of "GPRC6A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual