Rabbit GPRC6A Polyclonal Antibody | anti-GPRC6A antibody

GPRC6A Antibody - N-terminal region

Cat. Num. AAA3216421

• Gene Names: GPRC6A; GPCR; bA86F4.3
• Reactivity: Dog, Human, Mouse, Pig, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: GPRC6A; Polyclonal Antibody; GPRC6A Antibody - N-terminal region; anti-GPRC6A antibody

• Host: Rabbit
• Reactivity: Dog, Human, Mouse, Pig, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE
• Sequence Length: 926

• Applicable Applications for anti-GPRC6A antibody: Western Blot (WB)
• Homology: Dog: 77%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 79%; Rat: 77%
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPRC6ASample Tissue: Human HCT15 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GPRC6ASample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GPRC6A AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Related Product Information for anti-GPRC6A antibody

This is a rabbit polyclonal antibody against GPRC6A. It was validated on Western Blot

Target Description: Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain.

Product Categories/Family for anti-GPRC6A antibody

Polyclonal; Signaling Intermediate; Membrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 112807234
• NCBI GeneID: 222545
• NCBI Accession #: NP_683766
• NCBI GenBank Nucleotide #: NM_148963
• UniProt Accession #: Q5T6X5
• Molecular Weight: 103kDa
• NCBI Official Full Name: G-protein coupled receptor family C group 6 member A isoform 1
• NCBI Official Synonym Full Names: G protein-coupled receptor class C group 6 member A
• NCBI Official Symbol: GPRC6A
• NCBI Official Synonym Symbols: GPCR; bA86F4.3
• NCBI Protein Information: G-protein coupled receptor family C group 6 member A
• UniProt Protein Name: G-protein coupled receptor family C group 6 member A
• Protein Family: G-protein coupled receptor family
• UniProt Gene Name: GPRC6A
• UniProt Synonym Gene Names: hGPRC6A; hGPCR33
• UniProt Entry Name: GPC6A_HUMAN

NCBI Description

Members of family C of the G protein-coupled receptor (GPCR) superfamily, such as GPRC6A, are characterized by an evolutionarily conserved amino acid-sensing motif linked to an intramembranous 7-transmembrane loop region. Several members of GPCR family C, including GPRC6A, also have a long N-terminal domain (summary by Pi et al., 2005 [PubMed 16199532]).[supplied by OMIM, Nov 2010]

Uniprot Description

GPRC6A: Receptor activated by amino acids with a preference for basic amino acids such as L-Lys, L-Arg and L-ornithine but also by small and polar amino acids. The L-alpha amino acids respond is augmented by divalent cations Ca(2+) and Mg(2+). Activated by extracellular calcium and osteocalin. Seems to act through a G(q)/G(11) and G(i)-coupled pathway. Mediates the non-genomic effects of androgens in multiple tissue. May coordinates nutritional and hormonal anabolic signals through the sensing of extracellular amino acids, osteocalcin, divalents ions and its responsiveness to anabolic steroids. Belongs to the G-protein coupled receptor 3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 3; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q22.1

Cellular Component: cell surface; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; calcium-mediated signaling; response to amino acid stimulus