Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of DU145 cells, using GPR87 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Rabbit anti-Human GPR87 Polyclonal Antibody | anti-GPR87 antibody

GPR87 Polyclonal Antibody

Gene Names
GPR87; GPR95; FKSG78; KPG_002
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GPR87; Polyclonal Antibody; GPR87 Polyclonal Antibody; FKSG78; GPR95; KPG_002; anti-GPR87 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
HNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITLFLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVR
Sequence Length
358
Applicable Applications for anti-GPR87 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human GPR87
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Multi-pass membrane protein
Positive Samples
DU145
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of DU145 cells, using GPR87 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of DU145 cells, using GPR87 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-GPR87 antibody
This gene encodes a G protein-coupled receptor and is located in a cluster of G protein-couple receptor genes on chromosome 3. The encoded protein has been shown to be overexpressed in lung squamous cell carcinoma (PMID:18057535) and regulated by p53 (PMID:19602589).
Product Categories/Family for anti-GPR87 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 41kDa
Observed: 41kDa
NCBI Official Full Name
G-protein coupled receptor 87
NCBI Official Synonym Full Names
G protein-coupled receptor 87
NCBI Official Symbol
GPR87
NCBI Official Synonym Symbols
GPR95; FKSG78; KPG_002
NCBI Protein Information
G-protein coupled receptor 87
UniProt Protein Name
G-protein coupled receptor 87
UniProt Gene Name
GPR87
UniProt Synonym Gene Names
GPR95

NCBI Description

This gene encodes a G protein-coupled receptor and is located in a cluster of G protein-couple receptor genes on chromosome 3. The encoded protein has been shown to be overexpressed in lung squamous cell carcinoma (PMID:18057535) and regulated by p53 (PMID:19602589). [provided by RefSeq, Nov 2011]

Uniprot Description

Receptor for lysophosphatidic acid (LPA). Necessary for p53/TP53-dependent survival in response to DNA damage.

Research Articles on GPR87

Similar Products

Product Notes

The GPR87 gpr87 (Catalog #AAA9135148) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR87 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR87 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GPR87 gpr87 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HNQSIRVVVA VFFTCFLPYH LCRIPFTFSH LDRLLDESAQ KILYYCKEIT LFLSACNVCL DPIIYFFMCR SFSRRLFKKS NIRTRSESIR SLQSVRRSEV R. It is sometimes possible for the material contained within the vial of "GPR87, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.