Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using GPR32 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit GPR32 Polyclonal Antibody | anti-GPR32 antibody
GPR32 Rabbit pAb
Gene Names
GPR32; RVDR1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
GPR32; Polyclonal Antibody; GPR32 Rabbit pAb; RVDR1; anti-GPR32 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY
Applicable Applications for anti-GPR32 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:100-1:200
IHC: 1:100-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR32 (NP_001497.1).
Cellular Location
Cell membrane, Multi-pass membrane protein
Positive Samples
A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using GPR32 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of A-549 cells, using GPR32 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-GPR32 antibody
Background: This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19.
Product Categories/Family for anti-GPR32 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,087 Da
NCBI Official Full Name
probable G-protein coupled receptor 32
NCBI Official Synonym Full Names
G protein-coupled receptor 32
NCBI Official Symbol
GPR32
NCBI Official Synonym Symbols
RVDR1
NCBI Protein Information
probable G-protein coupled receptor 32; resolvin D1 receptor
UniProt Protein Name
Probable G-protein coupled receptor 32
Protein Family
UniProt Gene Name
GPR32
UniProt Entry Name
GPR32_HUMAN
NCBI Description
This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19. [provided by RefSeq, Nov 2012]
Uniprot Description
GPR32: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.
Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR
Chromosomal Location of Human Ortholog: 19q13.33
Cellular Component: integral to plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on GPR32
Similar Products
Product Notes
The GPR32 gpr32 (Catalog #AAA9142159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR32 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR32 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:100-1:200. Researchers should empirically determine the suitability of the GPR32 gpr32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNGVSEGTRG CSDRQPGVLT RDRSCSRKMN SSGCLSEEVG SLRPLTVVIL SASIVVGVLG NGLVLWMTVF RMARTVSTVC FFHLALADFM LSLSLPIAMY. It is sometimes possible for the material contained within the vial of "GPR32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
