Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

U7 snRNA-associated Sm-like protein LSm10 Recombinant Protein | LSM10 recombinant protein

Recombinant Human U7 snRNA-associated Sm-like protein LSm10

Gene Names
LSM10; MST074; MSTP074
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
U7 snRNA-associated Sm-like protein LSm10; Recombinant Human U7 snRNA-associated Sm-like protein LSm10; LSM10 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-123aa; Full Length
Sequence
MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYTDRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPKNCK
Sequence Length
123
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for LSM10 recombinant protein
Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner.
Product Categories/Family for LSM10 recombinant protein
References
Purified U7 snRNPs lack the Sm proteins D1 and D2 but contain Lsm10, a new 14 kDa Sm D1-like protein.Pillai R.S., Will C.L., Luehrmann R., Schuemperli D., Mueller B.EMBO J. 20:5470-5479(2001) Toward an assembly line for U7 snRNPs interactions of U7-specific Lsm proteins with PRMT5 and SMN complexes.Azzouz T.N., Pillai R.S., Dapp C., Chari A., Meister G., Kambach C., Fischer U., Schuemperli D.J. Biol. Chem. 280:34435-34440(2005) ZFP100, a component of the active U7 snRNP limiting for histone pre-mRNA processing, is required for entry into S phase.Wagner E.J., Marzluff W.F.Mol. Cell. Biol. 26:6702-6712(2006)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30.1 kDa
NCBI Official Full Name
U7 snRNA-associated Sm-like protein LSm10
NCBI Official Synonym Full Names
LSM10, U7 small nuclear RNA associated
NCBI Official Symbol
LSM10
NCBI Official Synonym Symbols
MST074; MSTP074
NCBI Protein Information
U7 snRNA-associated Sm-like protein LSm10
UniProt Protein Name
U7 snRNA-associated Sm-like protein LSm10
UniProt Gene Name
LSM10
UniProt Entry Name
LSM10_HUMAN

Uniprot Description

LSM10: Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed. Required for cell cycle progression from G1 to S phases. Binds specifically to U7 snRNA. Binds to the downstream cleavage product (DCP) of histone pre-mRNA in a U7 snRNP dependent manner. Belongs to the snRNP Sm proteins family.

Chromosomal Location of Human Ortholog: 1p34.3

Cellular Component: Cajal body; nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: gene expression; histone mRNA metabolic process; mRNA 3'-end processing; RNA splicing; termination of RNA polymerase II transcription; transcription from RNA polymerase II promoter

Research Articles on LSM10

Similar Products

Product Notes

The LSM10 lsm10 (Catalog #AAA1459534) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-123aa; Full Length. The amino acid sequence is listed below: MAVSHSVKER TISENSLIIL LQGLQGRVTT VDLRDESVAH GRIDNVDAFM NIRLAKVTYT DRWGHQVKLD DLFVTGRNVR YVHIPDDVNI TSTIEQQLQI IHRVRNFGGK GQGRWEFPPK NCK. It is sometimes possible for the material contained within the vial of "U7 snRNA-associated Sm-like protein LSm10, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.