Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung )

Rabbit GPNMB Polyclonal Antibody | anti-GPNMB antibody

GPNMB antibody - N-terminal region

Gene Names
GPNMB; NMB; HGFIN; PLCA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GPNMB; Polyclonal Antibody; GPNMB antibody - N-terminal region; anti-GPNMB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Specificity
100% homologous to both isoforms of hGPNMB
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN
Sequence Length
560
Applicable Applications for anti-GPNMB antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GPNMB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(Host: RabbitTarget Name: GPNMBSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPNMBSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GPNMBSample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPNMBSample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GPNMB Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-GPNMB Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-GPNMB antibody
This is a rabbit polyclonal antibody against GPNMB. It was validated on Western Blot and immunohistochemistry

Target Description: GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
transmembrane glycoprotein NMB isoform b
NCBI Official Synonym Full Names
glycoprotein nmb
NCBI Official Symbol
GPNMB
NCBI Official Synonym Symbols
NMB; HGFIN; PLCA3
NCBI Protein Information
transmembrane glycoprotein NMB
UniProt Protein Name
Transmembrane glycoprotein NMB
UniProt Gene Name
GPNMB
UniProt Synonym Gene Names
HGFIN; NMB
UniProt Entry Name
GPNMB_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GPNMB: Could be a melanogenic enzyme. Belongs to the PMEL/NMB family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: integral to plasma membrane; integral to membrane; melanosome

Molecular Function: heparin binding; integrin binding

Biological Process: osteoblast differentiation; negative regulation of cell proliferation; cell adhesion; bone mineralization

Research Articles on GPNMB

Similar Products

Product Notes

The GPNMB gpnmb (Catalog #AAA3207402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPNMB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPNMB can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GPNMB gpnmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DENDWNEKLY PVWKRGDMRW KNSWKGGRVQ AVLTSDSPAL VGSNITFAVN. It is sometimes possible for the material contained within the vial of "GPNMB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.