Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GPNMB is ~0.3ng/ml using as a capture antibody.)

Mouse anti-Human GPNMB Monoclonal Antibody | anti-GPNMB antibody

GPNMB (HGFIN, NMB, Transmembrane Glycoprotein NMB, Transmembrane Glycoprotein HGFIN) (MaxLight 405)

Gene Names
GPNMB; NMB; HGFIN; PLCA3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GPNMB; Monoclonal Antibody; GPNMB (HGFIN; NMB; Transmembrane Glycoprotein NMB; Transmembrane Glycoprotein HGFIN) (MaxLight 405); anti-GPNMB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A8
Specificity
Recognizes human GPNMB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
2686
Applicable Applications for anti-GPNMB antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa104-203 from human GPNMB with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GPNMB is ~0.3ng/ml using as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPNMB is ~0.3ng/ml using as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen using (37.11kD).)
Related Product Information for anti-GPNMB antibody
The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GPNMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens glycoprotein nmb (GPNMB), transcript variant 1, mRNA
NCBI Official Synonym Full Names
glycoprotein nmb
NCBI Official Symbol
GPNMB
NCBI Official Synonym Symbols
NMB; HGFIN; PLCA3
NCBI Protein Information
transmembrane glycoprotein NMB
UniProt Protein Name
Transmembrane glycoprotein NMB
UniProt Gene Name
GPNMB
UniProt Synonym Gene Names
HGFIN; NMB
UniProt Entry Name
GPNMB_HUMAN

NCBI Description

The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GPNMB: Could be a melanogenic enzyme. Belongs to the PMEL/NMB family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: integral to plasma membrane; integral to membrane; melanosome

Molecular Function: heparin binding; integrin binding

Biological Process: osteoblast differentiation; negative regulation of cell proliferation; cell adhesion; bone mineralization

Research Articles on GPNMB

Similar Products

Product Notes

The GPNMB gpnmb (Catalog #AAA6190398) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GPNMB (HGFIN, NMB, Transmembrane Glycoprotein NMB, Transmembrane Glycoprotein HGFIN) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPNMB can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPNMB gpnmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPNMB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.