Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of GPI expression in human placenta extract (lane 1) and JURKAT whole cell lysates (lane 2). GPI at 63KD was detected using rabbit anti- GPI Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human GPI Polyclonal Antibody | anti-GPI antibody

Anti-GPI Antibody

Gene Names
GPI; AMF; NLK; PGI; PHI; GNPI; SA36; SA-36
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
GPI; Polyclonal Antibody; Anti-GPI Antibody; AMF; Aurocrine motility factor; GNPI; Gpi1; Neuroleukin; NLK; Oxoisomerase; PGI; PHI; SA36; SA-36; SA 36; P06744; Glucose-6-phosphate isomerase; anti-GPI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
558
Applicable Applications for anti-GPI antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GPI (5-39aa TRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNH), different from the related mouse and rat sequences by sixteen amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of GPI expression in human placenta extract (lane 1) and JURKAT whole cell lysates (lane 2). GPI at 63KD was detected using rabbit anti- GPI Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of GPI expression in human placenta extract (lane 1) and JURKAT whole cell lysates (lane 2). GPI at 63KD was detected using rabbit anti- GPI Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-GPI antibody
Rabbit IgG polyclonal antibody for Glucose-6-phosphate isomerase(GPI) detection.
Background: Glucose-6-phosphate isomerase (GPI), alternatively known as phosphoglucose isomerase (PGI) or phosphohexose isomerase(PHI), is an enzyme that in humans is encoded by the GPI gene on chromosome 19. This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phophsate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants.
References
1. Haga A, Niinaka Y, Raz A (2000). "Phosphohexose isomerase/autocrine motility factor/neuroleukin/maturation factor is a multifunctional phosphoprotein.". Biochim. Biophys. Acta 1480(1-2): 235-44.
2. Kugler W, Lakomek M (March 2000). "Glucose-6-phosphate isomerase deficiency". Baillieres Best Pract. Res. Clin. Haematol. 13 (1): 89-101.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,325 Da
NCBI Official Full Name
glucose-6-phosphate isomerase isoform 2
NCBI Official Synonym Full Names
glucose-6-phosphate isomerase
NCBI Official Symbol
GPI
NCBI Official Synonym Symbols
AMF; NLK; PGI; PHI; GNPI; SA36; SA-36
NCBI Protein Information
glucose-6-phosphate isomerase
UniProt Protein Name
Glucose-6-phosphate isomerase
Protein Family
UniProt Gene Name
GPI
UniProt Synonym Gene Names
GPI; AMF; NLK; PGI; PHI; SA-36

NCBI Description

This gene encodes a member of the glucose phosphate isomerase protein family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. In the cytoplasm, the gene product functions as a glycolytic enzyme (glucose-6-phosphate isomerase) that interconverts glucose-6-phosphate and fructose-6-phosphate. Extracellularly, the encoded protein (also referred to as neuroleukin) functions as a neurotrophic factor that promotes survival of skeletal motor neurons and sensory neurons, and as a lymphokine that induces immunoglobulin secretion. The encoded protein is also referred to as autocrine motility factor based on an additional function as a tumor-secreted cytokine and angiogenic factor. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]

Uniprot Description

G6PI: belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. A dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. Functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Protein type: Apoptosis; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - pentose phosphate pathway; Carbohydrate Metabolism - starch and sucrose; Cytokine; EC 5.3.1.9; Isomerase

Chromosomal Location of Human Ortholog: 19q13.11

Cellular Component: cytoplasm; cytosol; membrane; nucleoplasm; plasma membrane

Molecular Function: glucose-6-phosphate isomerase activity; ubiquitin protein ligase binding

Biological Process: gluconeogenesis; hemostasis; humoral immune response

Disease: Hemolytic Anemia, Nonspherocytic, Due To Glucose Phosphate Isomerase Deficiency

Research Articles on GPI

Similar Products

Product Notes

The GPI gpi (Catalog #AAA178824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GPI Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the GPI gpi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.