Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged REV1L is approximately 0.03ng/ml as a capture antibody.)

Mouse ACBD3 Monoclonal Antibody | anti-ACBD3 antibody

ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3, GCP60, GOCAP1, GOLPH1, PAP7) (AP)

Gene Names
ACBD3; PAP7; GCP60; GOCAP1; GOLPH1
Applications
Western Blot
Purity
Purified
Synonyms
ACBD3; Monoclonal Antibody; ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3; GCP60; GOCAP1; GOLPH1; PAP7) (AP); Acyl-Coenzyme A Binding Domain Containing 3; PAP7; anti-ACBD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5F12
Specificity
Recognizes ACBD3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ACBD3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACBD3 (NP_073572, 73aa-171aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged REV1L is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged REV1L is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-ACBD3 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]
Product Categories/Family for anti-ACBD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
Golgi resident protein GCP60
NCBI Official Synonym Full Names
acyl-CoA binding domain containing 3
NCBI Official Symbol
ACBD3
NCBI Official Synonym Symbols
PAP7; GCP60; GOCAP1; GOLPH1
NCBI Protein Information
Golgi resident protein GCP60
UniProt Protein Name
Golgi resident protein GCP60
Protein Family
UniProt Gene Name
ACBD3
UniProt Synonym Gene Names
GCP60; GOCAP1; GOLPH1; GOCAP1; GOLPH1
UniProt Entry Name
GCP60_HUMAN

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq, Jul 2008]

Uniprot Description

ACBD3: Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.

Chromosomal Location of Human Ortholog: 1q42.12

Cellular Component: Golgi membrane; Golgi apparatus; mitochondrion; membrane; integral to membrane

Molecular Function: protein binding; acyl-CoA binding

Biological Process: transport; steroid biosynthetic process

Research Articles on ACBD3

Similar Products

Product Notes

The ACBD3 acbd3 (Catalog #AAA6165847) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACBD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACBD3 acbd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACBD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.