Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot - GPER1 Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using GPER1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)

Rabbit GPER1 Polyclonal Antibody | anti-GPER1 antibody

GPER1 Rabbit pAb

Gene Names
GPER1; mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Purity
Affinity purified
Synonyms
GPER1; Polyclonal Antibody; GPER1 Rabbit pAb; CEPR; CMKRL2; DRY12; FEG-1; GPCR-Br; GPER; GPR30; LERGU; LERGU2; LyGPR; mER; G-protein coupled estrogen receptor 1; anti-GPER1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Expressed in placenta, endothelial and epithelial cells, non laboring and laboring term myometrium, fibroblasts and cancer-associated fibroblasts (CAF), prostate cancer cells and invasive adenocarcinoma (at protein level). Ubiquitously expressed, but is most abundant in placenta. In brain regions, expressed as a 2.8 kb transcript in basal forebrain, frontal cortex, thalamus, hippocampus, caudate and putamen.
Purity/Purification
Affinity purified
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Applicable Applications for anti-GPER1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human GPER1 (NP_001496.1).MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLF
Positive Control
Mouse brain, Mouse heart, Rat brain
Conjugation
Unconjugated
Modification
Unmodified
Cell Position
Basolateral cell membrane, Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle membrane, Early endosome, Endoplasmic reticulum membrane, Golgi apparatus, Golgi apparatus membrane, Mitochondrion membrane, Multi-pass membrane protein, Nucleus, Recycling endosome, axon, cytoskeleton, dendrite, dendritic spine membrane, perinuclear region, postsynaptic cell membrane, postsynaptic density, synapse, trans-Golgi network
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot - GPER1 Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using GPER1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)

Western Blot (WB) (Western blot - GPER1 Polyclonal Antibody. Western blot analysis of extracts of various cell lines, using GPER1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Exposure time: 90s.)

Immunofluorescence (IF)

(Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of C6 cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of C6 cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of NIH/3T3 cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of NIH/3T3 cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of U2OS cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence - GPER1 Polyclonal Antibody. Immunofluorescence analysis of U2OS cells using GPER1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-GPER1 antibody
This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3, 4, 5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized.
Product Categories/Family for anti-GPER1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
42,248 Da
NCBI Official Full Name
G-protein coupled estrogen receptor 1
NCBI Official Synonym Full Names
G protein-coupled estrogen receptor 1
NCBI Official Symbol
GPER1
NCBI Official Synonym Symbols
mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br
NCBI Protein Information
G-protein coupled estrogen receptor 1; heptahelix receptor; chemokine receptor-like 2; IL8-related receptor DRY12; membrane estrogen receptor; G protein-coupled receptor 30; chemoattractant receptor-like 2; leucine rich protein in GPR30 3'UTR; lymphocyte-
UniProt Protein Name
G-protein coupled estrogen receptor 1
UniProt Gene Name
GPER1
UniProt Synonym Gene Names
CEPR; CMKRL2; DRY12; GPER; GPR30; FEG-1; LYGPR; mER
UniProt Entry Name
GPER1_HUMAN

NCBI Description

This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

GPER1: Receptor for estrogen. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 7p22.3

Cellular Component: Golgi apparatus; integral to plasma membrane; early endosome; dendrite; nuclear envelope; trans-Golgi network; recycling endosome; perinuclear region of cytoplasm; cytoplasm; keratin filament; intracellular; dendritic shaft; endoplasmic reticulum membrane; cytoplasmic vesicle membrane; endoplasmic reticulum; postsynaptic density; Golgi membrane; presynaptic membrane; axon; mitochondrial membrane; presynaptic active zone; plasma membrane; nerve terminal; nucleus; cell junction

Molecular Function: G-protein coupled receptor activity; protein binding; estrogen receptor activity; chromatin binding; mineralocorticoid receptor activity; steroid binding

Biological Process: positive regulation of apoptosis; generation of action potential; positive regulation of caspase activity; nuclear fragmentation during apoptosis; negative regulation of DNA metabolic process; positive regulation of vasodilation; positive regulation of neurotransmitter secretion; negative regulation of leukocyte activation; negative regulation of cell proliferation; elevation of cytosolic calcium ion concentration; positive regulation of MAPKKK cascade; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of cAMP biosynthetic process; positive regulation of cell proliferation; inflammatory response; steroid hormone receptor signaling pathway; positive regulation of neurogenesis; cytosolic calcium ion homeostasis; negative regulation of lipid biosynthetic process; positive regulation of insulin secretion; positive regulation of inositol trisphosphate biosynthetic process; cell cycle; negative regulation of fat cell differentiation; apoptotic chromosome condensation; positive regulation of phosphoinositide 3-kinase cascade; G-protein coupled receptor protein signaling pathway; mineralocorticoid receptor signaling pathway; negative regulation of inflammatory response; positive regulation of G-protein coupled receptor protein signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cell migration

Research Articles on GPER1

Similar Products

Product Notes

The GPER1 gper1 (Catalog #AAA4757672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPER1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPER1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the GPER1 gper1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPER1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.