Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GOT1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit GOT1 Polyclonal Antibody | anti-GOT1 antibody

GOT1 antibody - N-terminal region

Gene Names
GOT1; AST1; cCAT; GIG18; cAspAT; ASTQTL1
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GOT1; Polyclonal Antibody; GOT1 antibody - N-terminal region; anti-GOT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV
Sequence Length
413
Applicable Applications for anti-GOT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GOT1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GOT1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GOT1 antibody
This is a rabbit polyclonal antibody against GOT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-GOT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
aspartate aminotransferase, cytoplasmic
NCBI Official Synonym Full Names
glutamic-oxaloacetic transaminase 1
NCBI Official Symbol
GOT1
NCBI Official Synonym Symbols
AST1; cCAT; GIG18; cAspAT; ASTQTL1
NCBI Protein Information
aspartate aminotransferase, cytoplasmic
UniProt Protein Name
Aspartate aminotransferase, cytoplasmic
Protein Family
UniProt Gene Name
GOT1
UniProt Synonym Gene Names
cAspAT; cCAT
UniProt Entry Name
AATC_HUMAN

NCBI Description

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. [provided by RefSeq, Jul 2008]

Uniprot Description

GOT1: Plays a key role in amino acid metabolism. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.

Protein type: Amino Acid Metabolism - cysteine and methionine; Transferase; Amino Acid Metabolism - phenylalanine, tyrosine and tryptophan biosynthesis; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - tyrosine; EC 2.6.1.1; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - alanine, aspartate and glutamate; EC 2.6.1.3

Chromosomal Location of Human Ortholog: 10q24.1-q25.1

Cellular Component: lysosome; cytoplasm; nerve terminal; nucleus; cytosol

Molecular Function: cysteine transaminase activity; phosphatidylserine decarboxylase activity; carboxylic acid binding; aspartate transaminase activity; pyridoxal phosphate binding

Biological Process: glutamate metabolic process; oxaloacetate metabolic process; glutamate catabolic process to aspartate; response to glucocorticoid stimulus; glucose metabolic process; aspartate biosynthetic process; pathogenesis; gluconeogenesis; 2-oxoglutarate metabolic process; methionine salvage; cellular response to insulin stimulus; sulfur amino acid metabolic process; glycerol biosynthetic process; fatty acid homeostasis; carbohydrate metabolic process; aspartate catabolic process; aspartate metabolic process; amino acid biosynthetic process; glutamate catabolic process to 2-oxoglutarate; polyamine metabolic process

Disease: Aspartate Aminotransferase, Serum Level Of, Quantitative Trait Locus 1

Research Articles on GOT1

Similar Products

Product Notes

The GOT1 got1 (Catalog #AAA3208921) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOT1 antibody - N-terminal region reacts with Cow, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GOT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOT1 got1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAPPSVFAEV PQAQPVLVFK LTADFREDPD PRKVNLGVGA YRTDDCHPWV. It is sometimes possible for the material contained within the vial of "GOT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.