Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GNPTG expression in transfected 293T cell line by GNPTG polyclonal antibody. Lane 1: GNPTG transfected lysate (33.55kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GNPTG Polyclonal Antibody | anti-GNPTG antibody

GNPTG (N-acetylglucosamine-1-phosphotransferase Subunit gamma, GlcNAc-1-phosphotransferase Subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase Subunit gamma, C16orf27, GNPTAG, CAB56184, LP2537, c316G12.3)

Gene Names
GNPTG; RJD9; GNPTAG; LP2537; C16orf27
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GNPTG; Polyclonal Antibody; GNPTG (N-acetylglucosamine-1-phosphotransferase Subunit gamma; GlcNAc-1-phosphotransferase Subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase Subunit gamma; C16orf27; GNPTAG; CAB56184; LP2537; c316G12.3); Anti -GNPTG (N-acetylglucosamine-1-phosphotransferase Subunit gamma; anti-GNPTG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GNPTG.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL
Applicable Applications for anti-GNPTG antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GNPTG, aa19-305 (AAH14592).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GNPTG expression in transfected 293T cell line by GNPTG polyclonal antibody. Lane 1: GNPTG transfected lysate (33.55kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNPTG expression in transfected 293T cell line by GNPTG polyclonal antibody. Lane 1: GNPTG transfected lysate (33.55kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GNPTG antibody
May recognize the substrate of GlcNAc-1-phosphotransferase but also the lysosomal proteins with mannose-6-phosphate residues.
Product Categories/Family for anti-GNPTG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
33,974 Da
NCBI Official Full Name
GNPTG protein
NCBI Official Synonym Full Names
N-acetylglucosamine-1-phosphate transferase, gamma subunit
NCBI Official Symbol
GNPTG
NCBI Official Synonym Symbols
RJD9; GNPTAG; LP2537; C16orf27
NCBI Protein Information
N-acetylglucosamine-1-phosphotransferase subunit gamma; glcNAc-1-phosphotransferase subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma
UniProt Protein Name
N-acetylglucosamine-1-phosphotransferase subunit gamma
UniProt Gene Name
GNPTG
UniProt Synonym Gene Names
C16orf27; GNPTAG
UniProt Entry Name
GNPTG_HUMAN

NCBI Description

This gene encodes the gamma sunbunit of the N-acetylglucosamine-1-phosphotransferase complex. This hexameric complex, composed of alpha, beta and gamma subunits, catalyzes the first step in synthesis of a mannose 6-phosphate lysosomal recognition marker. This enzyme complex is necessary for targeting of lysosomal hydrolases to the lysosome. Mutations in the gene encoding the gamma subunit have been associated with mucolipidosis IIIC, also known as mucolipidosis III gamma.[provided by RefSeq, Feb 2010]

Uniprot Description

Function: May recognize the substrate of GlcNAc-1-phosphotransferase but also the lysosomal proteins with mannose-6-phosphate residues. Ref.1

Subunit structure: Hexamer of two alpha, two beta and two gamma subunit; disulfide-linked. It is believed that the alpha and/or the beta subunit of the enzyme contain the catalytic portion and that the gamma subunit functions in recognition of the lysosomal enzymes. Ref.1

Subcellular location: Secreted

By similarity. Golgi apparatus

By similarity.

Tissue specificity: Widely expressed. Ref.1

Involvement in disease: Mucolipidosis type III complementation group C (MLIIIC) [MIM:252605]: Autosomal recessive disease of lysosomal hydrolase trafficking. Unlike the related diseases, mucolipidosis II and IIIA, the enzyme affected in mucolipidosis IIIC (GlcNAc-phosphotransferase) retains full transferase activity on synthetic substrates but lacks activity on lysosomal hydrolases. Typical clinical findings include stiffness of the hands and shoulders, claw-hand deformity, scoliosis, short stature, coarse facies, and mild mental retardation. Radiographically, severe dysostosis multiplex of the hip is characteristic and frequently disabling. The clinical diagnosis can be confirmed by finding elevated serum lysosomal enzyme levels and/or decreased lysosomal enzyme levels in cultured fibroblasts.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.1

Sequence similarities: Contains 1 PRKCSH domain.

Sequence caution: The sequence AAP34456.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on GNPTG

Similar Products

Product Notes

The GNPTG gnptg (Catalog #AAA647874) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNPTG (N-acetylglucosamine-1-phosphotransferase Subunit gamma, GlcNAc-1-phosphotransferase Subunit gamma, UDP-N-acetylglucosamine-1-phosphotransferase Subunit gamma, C16orf27, GNPTAG, CAB56184, LP2537, c316G12.3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNPTG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GNPTG gnptg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PAPAGAAKMK VVEEPNAFGV NNPFLPQASR LQAKRDPSPV SGPVHLFRLS GKCFSLVEST YKYEFCPFHN VTQHEQTFRW NAYSGILGIW HEWEIANNTF TGMWMRDGDA CRSRSRQSKV ELACGKSNRL AHVSEPSTCV YALTFETPLV CHPHALLVYP TLPEALQRQW DRVEQDLADE LITPQGHEKL LRTLFEDAGY LKTPENEPTQ LEGGPDSLGF ETLENCRKAH KELSKEIKRL KGLLTQHGIP YTRPTETSNL EHLGHETPRA KSPEQLRGDP GLRGSL. It is sometimes possible for the material contained within the vial of "GNPTG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.